BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000338-TA|BGIBMGA000338-PA|IPR000618|Insect cuticle protein, IPR000437|Prokaryotic membrane lipoprotein lipid attachment site (154 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 25 6.8 SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizos... 25 6.8 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 24.6 bits (51), Expect = 6.8 Identities = 14/44 (31%), Positives = 19/44 (43%) Query: 74 EAQVAQGSFTYTSPEGIPISVSYVADENGFRPEGAHLPTPPPIP 117 +A + + + T TS PI S + R P PPPIP Sbjct: 214 KAYLNESAGTPTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIP 257 >SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1649 Score = 24.6 bits (51), Expect = 6.8 Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 34 ILSQSQDVNFDGSYQFSY 51 +L +S ++ DG+Y FSY Sbjct: 581 LLDRSSEIGLDGTYLFSY 598 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.315 0.132 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 559,006 Number of Sequences: 5004 Number of extensions: 21741 Number of successful extensions: 56 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 53 Number of HSP's gapped (non-prelim): 3 length of query: 154 length of database: 2,362,478 effective HSP length: 67 effective length of query: 87 effective length of database: 2,027,210 effective search space: 176367270 effective search space used: 176367270 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -