BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000337-TA|BGIBMGA000337-PA|IPR000618|Insect cuticle protein (157 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 25 0.30 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 25 0.40 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 25.0 bits (52), Expect = 0.30 Identities = 16/65 (24%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Query: 13 TLAVFYAVHAQQHSINDPIPIIRYESDG-PNPDGSYKWLYETGNEINAEETGYVKNFGKG 71 T A+ + + IND + + + +P + K+ Y +GN ET +NFG Sbjct: 384 TFRELVAMFSDRIFINDIVKTAKLMAKSMKSPTYALKFEYRSGNSWFEHETESGRNFGAA 443 Query: 72 EGEEV 76 ++V Sbjct: 444 HADDV 448 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 24.6 bits (51), Expect = 0.40 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 19 AVHAQQHSINDPIPIIRYESDG-PNPDGSYKWLYETGNEINAEETGYVKNFGKGEGEEV 76 A+ + + IND + + + +P + K+ Y +GN ET +NFG ++V Sbjct: 390 AMFSDRIFINDIVKTAKLMAKSMKSPTYALKFEYRSGNSWFEHETESGRNFGAAHADDV 448 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.134 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,307 Number of Sequences: 317 Number of extensions: 1692 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 157 length of database: 114,650 effective HSP length: 52 effective length of query: 105 effective length of database: 98,166 effective search space: 10307430 effective search space used: 10307430 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (20.9 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -