BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000337-TA|BGIBMGA000337-PA|IPR000618|Insect cuticle protein (157 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 25 1.5 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 25 1.5 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 25 1.5 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 25 1.5 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 25 1.5 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.6 bits (51), Expect = 1.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 18 YAVHAQQHSINDPIPIIRYESDGPNPDGSYKWLYET 53 +A HA+ + D Y D PDG +W ++T Sbjct: 46 FAFHARLNKPFDQFEEGDYTEDVTAPDGDGRWTFDT 81 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.6 bits (51), Expect = 1.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 18 YAVHAQQHSINDPIPIIRYESDGPNPDGSYKWLYET 53 +A HA+ + D Y D PDG +W ++T Sbjct: 46 FAFHARLNKPFDQFEEGDYTEDVTAPDGDGRWTFDT 81 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.6 bits (51), Expect = 1.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 18 YAVHAQQHSINDPIPIIRYESDGPNPDGSYKWLYET 53 +A HA+ + D Y D PDG +W ++T Sbjct: 46 FAFHARLNKPFDQFEEGDYTEDVTAPDGDGRWTFDT 81 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 24.6 bits (51), Expect = 1.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 18 YAVHAQQHSINDPIPIIRYESDGPNPDGSYKWLYET 53 +A HA+ + D Y D PDG +W ++T Sbjct: 46 FAFHARLNKPFDQFEEGDYTEDVTAPDGDGRWTFDT 81 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.6 bits (51), Expect = 1.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 18 YAVHAQQHSINDPIPIIRYESDGPNPDGSYKWLYET 53 +A HA+ + D Y D PDG +W ++T Sbjct: 46 FAFHARLNKPFDQFEEGDYTEDVTAPDGDGRWTFDT 81 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.313 0.134 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,917 Number of Sequences: 2123 Number of extensions: 7183 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 5 length of query: 157 length of database: 516,269 effective HSP length: 59 effective length of query: 98 effective length of database: 391,012 effective search space: 38319176 effective search space used: 38319176 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -