BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000334-TA|BGIBMGA000334-PA|IPR000618|Insect cuticle protein (136 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 77 7e-17 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 0.88 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 0.88 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 20 8.2 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 77.0 bits (181), Expect = 7e-17 Identities = 40/106 (37%), Positives = 64/106 (60%), Gaps = 4/106 (3%) Query: 24 SDQTAEIIKQDFDQQVDGSYQFSYETDNGIKAEETGSLKKASGPDASDVIIAQGAFSYTA 83 +D+ A I Q + DG+Y ++ET NGI +E+G K+ D +++QG+ SYTA Sbjct: 23 ADKDAVITSQQLEVNFDGNYINNFETSNGISHQESGQPKQV---DNETPVVSQGSDSYTA 79 Query: 84 PDGTVISLNYVADDDGGFKPEGAHLXXXXXXXXAIQKALDFLATAP 129 PDG +S+ YVAD++ GF+ +G+H+ IQ+AL++ A P Sbjct: 80 PDGQQVSITYVADEN-GFQVQGSHIPTAPPIPPEIQRALEWNAAHP 124 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 0.88 Identities = 13/40 (32%), Positives = 20/40 (50%) Query: 52 GIKAEETGSLKKASGPDASDVIIAQGAFSYTAPDGTVISL 91 G+K T +L K S P+ + Q FSY G +++L Sbjct: 262 GLKYYVTPNLSKLSDPEVWIDAVTQIFFSYALGLGALVAL 301 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 0.88 Identities = 13/40 (32%), Positives = 20/40 (50%) Query: 52 GIKAEETGSLKKASGPDASDVIIAQGAFSYTAPDGTVISL 91 G+K T +L K S P+ + Q FSY G +++L Sbjct: 315 GLKYYVTPNLSKLSDPEVWIDAVTQIFFSYALGLGALVAL 354 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.2 bits (40), Expect = 8.2 Identities = 6/8 (75%), Positives = 8/8 (100%) Query: 129 PPPPSSRN 136 PPPPS++N Sbjct: 765 PPPPSAQN 772 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.312 0.131 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,457 Number of Sequences: 429 Number of extensions: 1337 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 136 length of database: 140,377 effective HSP length: 52 effective length of query: 84 effective length of database: 118,069 effective search space: 9917796 effective search space used: 9917796 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (20.9 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -