BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000333-TA|BGIBMGA000333-PA|IPR000618|Insect cuticle protein (174 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 28 0.049 DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 23 1.8 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 4.2 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 7.4 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 20 9.8 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 27.9 bits (59), Expect = 0.049 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Query: 109 NPPAVPVVAQGSFSWTSPEGVPISVNYVADENGYQPTGNAIPTSPPV 155 +P A+ QGS S S EGVP+ V +G G+ SPPV Sbjct: 1086 DPVALKSAQQGSSS--SSEGVPLKGTAVPPPSGSSGPGSTGSKSPPV 1130 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 22.6 bits (46), Expect = 1.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 146 GNAIPTSPPVPEQIARALAYIAKNIP 171 G+ +P +QI + LA++ KN P Sbjct: 75 GSCPQCTPQEMKQIQKVLAFVQKNYP 100 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.4 bits (43), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Query: 73 VKFGNEINPDGSYTYFY 89 +KFG + +P+G Y Y Sbjct: 429 IKFGRKADPNGDYIRKY 445 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 20.6 bits (41), Expect = 7.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 138 DENGYQPTGNAIPTSPPVPEQIA 160 D+NG++ N T P V Q+A Sbjct: 78 DQNGFRNFTNLKKTHPKVKLQVA 100 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 20.2 bits (40), Expect = 9.8 Identities = 10/28 (35%), Positives = 13/28 (46%) Query: 115 VVAQGSFSWTSPEGVPISVNYVADENGY 142 +V G F+ VPI+V DE Y Sbjct: 313 IVFNGLFTEEDVADVPINVTLSLDEKKY 340 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.134 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,977 Number of Sequences: 317 Number of extensions: 2447 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 174 length of database: 114,650 effective HSP length: 53 effective length of query: 121 effective length of database: 97,849 effective search space: 11839729 effective search space used: 11839729 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.0 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -