BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000332-TA|BGIBMGA000332-PA|IPR000618|Insect cuticle protein (166 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0066 - 16145398-16145475,16145638-16145700,16146432-161465... 29 2.5 10_08_0108 + 14860469-14861032 28 3.3 >06_03_0066 - 16145398-16145475,16145638-16145700,16146432-16146518, 16147168-16147246,16147359-16147478,16149289-16149440 Length = 192 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 85 ISAQAQGTPRDFGGNPPVVPVVSQGSFAWTSPEGQPIVITY 125 + A G P+D G + ++P S+ F EG+P+V+ + Sbjct: 49 VGAYYTGYPKDLGPSR-IIPFTSERQFVQLLHEGRPVVVAF 88 >10_08_0108 + 14860469-14861032 Length = 187 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 92 TPRDFGGN-PPVVPVVSQGSFAWTSPEGQPIVIT 124 TP D GGN PPV+P ++ G G P V T Sbjct: 108 TPLDAGGNAPPVLPALNGGQPGEEEAAGTPRVAT 141 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.311 0.131 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,966,800 Number of Sequences: 37544 Number of extensions: 168553 Number of successful extensions: 241 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 241 Number of HSP's gapped (non-prelim): 2 length of query: 166 length of database: 14,793,348 effective HSP length: 77 effective length of query: 89 effective length of database: 11,902,460 effective search space: 1059318940 effective search space used: 1059318940 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -