BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000331-TA|BGIBMGA000331-PA|IPR000618|Insect cuticle protein (210 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 2.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 7.2 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 7.2 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 7.2 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 7.2 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 7.2 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 7.2 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 7.2 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 7.2 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.6 bits (46), Expect = 2.4 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Query: 71 AKALNQQLLTPFVKYGNG-----IEQTAEPSVATVTYRPPVVSTYRP 112 A A Q++ T FV++ N + A PS +T RP + RP Sbjct: 10 AGAPPQEMPTWFVRWLNSQQPRNVPNFAAPSTSTAVQRPQAILQVRP 56 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 154 TDNGIAAEESGSVEPTVNGGGTRT 177 +D+ + +ES + + GG TRT Sbjct: 12 SDDNFSDDESSPLTENIYGGSTRT 35 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 154 TDNGIAAEESGSVEPTVNGGGTRT 177 +D+ + +ES + + GG TRT Sbjct: 12 SDDNFSDDESSPLTENIYGGSTRT 35 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 154 TDNGIAAEESGSVEPTVNGGGTRT 177 +D+ + +ES + + GG TRT Sbjct: 12 SDDNFSDDESSPLTENIYGGSTRT 35 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 154 TDNGIAAEESGSVEPTVNGGGTRT 177 +D+ + +ES + + GG TRT Sbjct: 12 SDDNFSDDESSPLTENIYGGSTRT 35 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/23 (43%), Positives = 11/23 (47%) Query: 94 EPSVATVTYRPPVVSTYRPLVYS 116 + S T Y P STY P YS Sbjct: 22 QSSPGTDYYNPNANSTYPPACYS 44 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/23 (43%), Positives = 11/23 (47%) Query: 94 EPSVATVTYRPPVVSTYRPLVYS 116 + S T Y P STY P YS Sbjct: 22 QSSPGTDYYNPNANSTYPPACYS 44 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/23 (43%), Positives = 11/23 (47%) Query: 94 EPSVATVTYRPPVVSTYRPLVYS 116 + S T Y P STY P YS Sbjct: 22 QSSPGTDYYNPNANSTYPPACYS 44 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/23 (43%), Positives = 11/23 (47%) Query: 94 EPSVATVTYRPPVVSTYRPLVYS 116 + S T Y P STY P YS Sbjct: 22 QSSPGTDYYNPNANSTYPPACYS 44 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/23 (43%), Positives = 11/23 (47%) Query: 94 EPSVATVTYRPPVVSTYRPLVYS 116 + S T Y P STY P YS Sbjct: 22 QSSPGTDYYNPNANSTYPPACYS 44 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/23 (43%), Positives = 11/23 (47%) Query: 94 EPSVATVTYRPPVVSTYRPLVYS 116 + S T Y P STY P YS Sbjct: 22 QSSPGTDYYNPNANSTYPPACYS 44 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/23 (43%), Positives = 11/23 (47%) Query: 94 EPSVATVTYRPPVVSTYRPLVYS 116 + S T Y P STY P YS Sbjct: 22 QSSPGTDYYNPNANSTYPPACYS 44 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/23 (43%), Positives = 11/23 (47%) Query: 94 EPSVATVTYRPPVVSTYRPLVYS 116 + S T Y P STY P YS Sbjct: 22 QSSPGTDYYNPNANSTYPPACYS 44 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.134 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,964 Number of Sequences: 317 Number of extensions: 2771 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of query: 210 length of database: 114,650 effective HSP length: 54 effective length of query: 156 effective length of database: 97,532 effective search space: 15214992 effective search space used: 15214992 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -