BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000331-TA|BGIBMGA000331-PA|IPR000618|Insect cuticle protein (210 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 32 0.011 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 25 1.3 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 25 1.3 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 25 1.3 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 25 1.3 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 25 1.3 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 25 1.3 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 25 1.3 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 25 1.3 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 25 1.3 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 25 1.3 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 25 1.3 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 25 1.3 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 25 1.7 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 25 2.2 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 5.1 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 5.1 AY724802-1|AAW50311.1| 134|Anopheles gambiae G protein alpha su... 23 5.1 AY724801-1|AAW50310.1| 134|Anopheles gambiae G protein alpha su... 23 5.1 DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. 23 6.7 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 32.3 bits (70), Expect = 0.011 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 174 GTRTRGFYEYVGDDGLKYRVDYTAD-ENGFKPV 205 G +G Y V DG K VDYTAD NGF V Sbjct: 46 GDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAV 78 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 25.4 bits (53), Expect = 1.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 172 GGGTRTRGFYEYVGDDGLKYRVDYTADENGFKP 204 GGG G Y+ + +DG+ + GF+P Sbjct: 21 GGGGGPSGMYDNISNDGIPMDALAELQDTGFEP 53 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 147 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 147 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 116 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 171 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 147 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 147 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.0 bits (52), Expect = 1.7 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG + VDY AD + GF V Sbjct: 84 YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.6 bits (51), Expect = 2.2 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Query: 152 YETDNGIAAEESGSVEPT-VNGGGTRTRGFYEYVGDDGLKYRVDYTADEN-GFKPV 205 YE + E +G ++ G G Y + DG VDY AD + GF V Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGFNAV 147 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 5.1 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Query: 43 NSFDGRYRSLLNRNSK--YQSIYNAYQPYYAKALNQQLLTPFVKY-GNG 88 NS R L+ NS+ YQ Y+ +P Y + LT + Y G+G Sbjct: 2073 NSLGLPKRVLIQPNSRHAYQRTYHYNEPGYLTRIEDPYLTETIDYSGSG 2121 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 5.1 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Query: 43 NSFDGRYRSLLNRNSK--YQSIYNAYQPYYAKALNQQLLTPFVKY-GNG 88 NS R L+ NS+ YQ Y+ +P Y + LT + Y G+G Sbjct: 2074 NSLGLPKRVLIQPNSRHAYQRTYHYNEPGYLTRIEDPYLTETIDYSGSG 2122 >AY724802-1|AAW50311.1| 134|Anopheles gambiae G protein alpha subunit AgOn protein. Length = 134 Score = 23.4 bits (48), Expect = 5.1 Identities = 8/13 (61%), Positives = 12/13 (92%) Query: 110 YRPLVYSSTVKPL 122 YRP+VYS+T++ L Sbjct: 56 YRPVVYSNTIQSL 68 >AY724801-1|AAW50310.1| 134|Anopheles gambiae G protein alpha subunit AgOa protein. Length = 134 Score = 23.4 bits (48), Expect = 5.1 Identities = 8/13 (61%), Positives = 12/13 (92%) Query: 110 YRPLVYSSTVKPL 122 YRP+VYS+T++ L Sbjct: 56 YRPVVYSNTIQSL 68 >DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. Length = 353 Score = 23.0 bits (47), Expect = 6.7 Identities = 8/13 (61%), Positives = 12/13 (92%) Query: 110 YRPLVYSSTVKPL 122 YRP+VYS+T++ L Sbjct: 68 YRPVVYSNTIQGL 80 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.314 0.134 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 248,267 Number of Sequences: 2123 Number of extensions: 11235 Number of successful extensions: 26 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 15 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 20 length of query: 210 length of database: 516,269 effective HSP length: 61 effective length of query: 149 effective length of database: 386,766 effective search space: 57628134 effective search space used: 57628134 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -