BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000330-TA|BGIBMGA000330-PA|undefined (267 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 1.8 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 21 7.3 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 9.7 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 23.4 bits (48), Expect = 1.8 Identities = 14/47 (29%), Positives = 24/47 (51%) Query: 152 YPYIHKVIKGLVEKYVSFDGLHFGNEYDSSSNHFKKVYADKEIAVKC 198 Y I+ V++ L++KY + + G +SN K V AD + +C Sbjct: 158 YFLIYAVLEMLLQKYKTVTYVMTGQLKAQNSNLLKSVCADLCLLSEC 204 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/21 (38%), Positives = 14/21 (66%) Query: 152 YPYIHKVIKGLVEKYVSFDGL 172 YP +H + + L E +V+ +GL Sbjct: 76 YPSVHFISRKLGEDFVTCNGL 96 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Query: 244 VANSLKNKLKLEYEVFVR 261 VA KN L+ YE FVR Sbjct: 392 VAQIFKNLLENHYEEFVR 409 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.139 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,527 Number of Sequences: 317 Number of extensions: 1958 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 267 length of database: 114,650 effective HSP length: 56 effective length of query: 211 effective length of database: 96,898 effective search space: 20445478 effective search space used: 20445478 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -