BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000330-TA|BGIBMGA000330-PA|undefined (267 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC646.13 |sds23|psp1, moc1|inducer of sexual development Sds23... 27 2.1 SPAC458.05 |pik3|vps34|phosphatidylinositol 3-kinase Pik3|Schizo... 27 2.1 SPAC3C7.09 |set8||lysine methyltransferase Set8 |Schizosaccharom... 26 6.5 SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Ma... 25 8.6 SPAC25H1.08c |||ribosome biogenesis protein Sqt1|Schizosaccharom... 25 8.6 >SPBC646.13 |sds23|psp1, moc1|inducer of sexual development Sds23/Moc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 408 Score = 27.5 bits (58), Expect = 2.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 204 NFKVNETSEFVTQYPPTVNLPNGE 227 +F VN S+F+ Q+P NLP+ + Sbjct: 18 SFGVNSVSDFLAQFPIPTNLPSNK 41 >SPAC458.05 |pik3|vps34|phosphatidylinositol 3-kinase Pik3|Schizosaccharomyces pombe|chr 1|||Manual Length = 801 Score = 27.5 bits (58), Expect = 2.1 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Query: 166 YVSFDGLHFGNEYDSSSNHFKKVYADKEIAVKCKYLTPNFKVNETSEFVTQYPPTVNLPN 225 Y SFD L + + H + V + + + K L PN K+ + E + YPP+ L Sbjct: 227 YSSFD-LELNLDSPAELKHRRLVRSQRNGPLD-KDLKPNSKIRKELESILSYPPSEELSL 284 Query: 226 GEK 228 EK Sbjct: 285 EEK 287 >SPAC3C7.09 |set8||lysine methyltransferase Set8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 429 Score = 25.8 bits (54), Expect = 6.5 Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 206 KVNETSEFVTQYPPTVNLPNGEKFGSYYSFRGTKILDTV 244 + N+ +F+T P ++N P YS +GT I + V Sbjct: 99 RTNKWDKFLTVLPLSINTPAQWPEKEVYSLQGTSIFNPV 137 >SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual Length = 963 Score = 25.4 bits (53), Expect = 8.6 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 7/55 (12%) Query: 200 YLTPNFKVNETSEFVTQYPPTVN------LPNGEKFGSYYSFRGTKILDTVANSL 248 Y TP +N ++E + YPP LP+ + YSF G+ IL T + SL Sbjct: 122 YSTPYTTMNPSNE-MHPYPPATFENNYSVLPDHSSQPNAYSFTGSNILPTQSPSL 175 >SPAC25H1.08c |||ribosome biogenesis protein Sqt1|Schizosaccharomyces pombe|chr 1|||Manual Length = 399 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 178 YDSSSNHFKKVYADKEIAVKCKYLTPN 204 YDS+S F+K ++ + CK+L PN Sbjct: 312 YDSASLKFRKSLPHEQAVIDCKFL-PN 337 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.319 0.139 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 975,534 Number of Sequences: 5004 Number of extensions: 37123 Number of successful extensions: 77 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 74 Number of HSP's gapped (non-prelim): 5 length of query: 267 length of database: 2,362,478 effective HSP length: 72 effective length of query: 195 effective length of database: 2,002,190 effective search space: 390427050 effective search space used: 390427050 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -