GeneModel BLAST Result against rice

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000330-TA|BGIBMGA000330-PA|undefined
         (267 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_01_0610 - 7997406-7998047,7998379-7998426,8000719-8001143,800...    28   9.0  

>04_01_0610 -
           7997406-7998047,7998379-7998426,8000719-8001143,
           8002301-8002589
          Length = 467

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 175 GNEYDSSSNHFKKVY-ADKEIAVKCKYLTPNFKVNETSEFVTQYPPTVNLPNGEKFGSYY 233
           G E   +S+    VY A+ +I  + +    N +V E  +FV +Y   V    GE    + 
Sbjct: 154 GEEEKEASSTVPAVYDANADIEEEYRLFLENVRVYENDDFVVEYEGVVVRYGGEAVADHG 213

Query: 234 SFRG 237
           + RG
Sbjct: 214 AGRG 217


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.319    0.139    0.414 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,717,292
Number of Sequences: 37544
Number of extensions: 197932
Number of successful extensions: 345
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 345
Number of HSP's gapped (non-prelim): 1
length of query: 267
length of database: 14,793,348
effective HSP length: 81
effective length of query: 186
effective length of database: 11,752,284
effective search space: 2185924824
effective search space used: 2185924824
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 59 (27.9 bits)