BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000329-TA|BGIBMGA000329-PA|IPR000618|Insect cuticle protein (342 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC108310-1|AAI08311.1| 376|Homo sapiens WW domain binding prote... 31 4.5 BC104879-1|AAI04880.1| 376|Homo sapiens WW domain-containing bi... 31 4.5 AL157877-5|CAI13223.1| 376|Homo sapiens WW domain binding prote... 31 4.5 AF071185-1|AAC34811.1| 376|Homo sapiens formin binding protein ... 31 4.5 >BC108310-1|AAI08311.1| 376|Homo sapiens WW domain binding protein 4 (formin binding protein 21) protein. Length = 376 Score = 31.5 bits (68), Expect = 4.5 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 3/110 (2%) Query: 165 RYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFY-EYVGPDGVTYRVDY 223 R+ + EGYHY Y+ + A + K E + + VK + E + DG TY + Sbjct: 127 RWVEGITSEGYHYYYDLISG--ASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNT 184 Query: 224 TADENGFVADGAHIPNASRTSATTIHAFSQIKASHRQSSHSKPASQPQQD 273 E+ + IP+ S ++ ++ S +SS S S +Q+ Sbjct: 185 ETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQE 234 >BC104879-1|AAI04880.1| 376|Homo sapiens WW domain-containing binding protein 4 protein. Length = 376 Score = 31.5 bits (68), Expect = 4.5 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 3/110 (2%) Query: 165 RYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFY-EYVGPDGVTYRVDY 223 R+ + EGYHY Y+ + A + K E + + VK + E + DG TY + Sbjct: 127 RWVEGITSEGYHYYYDLISG--ASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNT 184 Query: 224 TADENGFVADGAHIPNASRTSATTIHAFSQIKASHRQSSHSKPASQPQQD 273 E+ + IP+ S ++ ++ S +SS S S +Q+ Sbjct: 185 ETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQE 234 >AL157877-5|CAI13223.1| 376|Homo sapiens WW domain binding protein 4 (formin binding protein 21) protein. Length = 376 Score = 31.5 bits (68), Expect = 4.5 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 3/110 (2%) Query: 165 RYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFY-EYVGPDGVTYRVDY 223 R+ + EGYHY Y+ + A + K E + + VK + E + DG TY + Sbjct: 127 RWVEGITSEGYHYYYDLISG--ASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNT 184 Query: 224 TADENGFVADGAHIPNASRTSATTIHAFSQIKASHRQSSHSKPASQPQQD 273 E+ + IP+ S ++ ++ S +SS S S +Q+ Sbjct: 185 ETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQE 234 >AF071185-1|AAC34811.1| 376|Homo sapiens formin binding protein 21 protein. Length = 376 Score = 31.5 bits (68), Expect = 4.5 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 3/110 (2%) Query: 165 RYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFY-EYVGPDGVTYRVDY 223 R+ + EGYHY Y+ + A + K E + + VK + E + DG TY + Sbjct: 127 RWVEGITSEGYHYYYDLISG--ASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNT 184 Query: 224 TADENGFVADGAHIPNASRTSATTIHAFSQIKASHRQSSHSKPASQPQQD 273 E+ + IP+ S ++ ++ S +SS S S +Q+ Sbjct: 185 ETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQE 234 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.313 0.130 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,491,935 Number of Sequences: 224733 Number of extensions: 1658328 Number of successful extensions: 2872 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 2868 Number of HSP's gapped (non-prelim): 4 length of query: 342 length of database: 73,234,838 effective HSP length: 90 effective length of query: 252 effective length of database: 53,008,868 effective search space: 13358234736 effective search space used: 13358234736 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 66 (30.7 bits)
- SilkBase 1999-2023 -