BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000329-TA|BGIBMGA000329-PA|IPR000618|Insect cuticle protein (342 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97593-6|AAB52879.2| 925|Caenorhabditis elegans Prion-like-(q/n... 29 4.8 >U97593-6|AAB52879.2| 925|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 22, isoform c protein. Length = 925 Score = 29.1 bits (62), Expect = 4.8 Identities = 28/121 (23%), Positives = 46/121 (38%), Gaps = 5/121 (4%) Query: 218 TYRVDYTADENGFVADGAHI-PNASRTSATTIHAFSQIKASHRQSSHSKPASQPQQDHRS 276 T +VDY +G H P +SAT + S + SS + P P Q H S Sbjct: 489 TNQVDYVLGHKDKYNEGPHYQPPIINSSATAANNSSSSTHHYNSSSQAIPLGGPNQGHSS 548 Query: 277 RL----TALPDPTARTYTASSRSIQAQSRLTVDFEQHWRQSRSIQAQFRLTGNFEQHWHL 332 T + +++ S Q S + + Q++SI Q + N+ + + Sbjct: 549 SSYTTETRVTGGGTGAPVSNNYSNQNYSSSAYNSQSSQHQTKSIPVQNYQSSNYNKSYSS 608 Query: 333 Q 333 Q Sbjct: 609 Q 609 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.313 0.130 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,575,794 Number of Sequences: 27539 Number of extensions: 290445 Number of successful extensions: 645 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 645 Number of HSP's gapped (non-prelim): 1 length of query: 342 length of database: 12,573,161 effective HSP length: 82 effective length of query: 260 effective length of database: 10,314,963 effective search space: 2681890380 effective search space used: 2681890380 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -