GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000328-TA|BGIBMGA000328-PA|IPR000618|Insect cuticle
protein
         (159 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ414247-1|ABD63009.2|  414|Tribolium castaneum paired protein.        21   5.0  

>DQ414247-1|ABD63009.2|  414|Tribolium castaneum paired protein.
          Length = 414

 Score = 21.0 bits (42), Expect = 5.0
 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 95  LAIQGQYEYSAP-DGTPVKFTYTADENGYQP 124
           L I  ++ +  P  GT  K+T  +D +G+ P
Sbjct: 7   LGIMHRHCFGYPFQGTTYKYTGCSDNDGFLP 37


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.315    0.134    0.386 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,257
Number of Sequences: 317
Number of extensions: 1392
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 159
length of database: 114,650
effective HSP length: 52
effective length of query: 107
effective length of database: 98,166
effective search space: 10503762
effective search space used: 10503762
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.1 bits)
S2: 40 (20.2 bits)