BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000328-TA|BGIBMGA000328-PA|IPR000618|Insect cuticle protein (159 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 32 0.010 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 27 0.28 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 25 1.1 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 4.6 Y17699-1|CAA76819.1| 81|Anopheles gambiae hypothetical protein... 23 6.1 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 22 8.0 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 22 8.0 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 22 8.0 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 22 8.0 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 31.9 bits (69), Expect = 0.010 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Query: 78 ISAQSSGSLKKVDNIDVLAIQGQYEYSAPDGTPVKFTYTAD-ENGYQPQSELLPVAPPMP 136 + A + S + ++ D +QG Y PDGT YTAD NG+ P+A Sbjct: 30 LGALTGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVRREPLAAKTI 89 Query: 137 EAIRRAIDYILAHP 150 A ++A P Sbjct: 90 VAAAPVATKVIAQP 103 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 27.1 bits (57), Expect = 0.28 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Query: 61 TEVNPD-GFSFGYETDNGISAQSSGSLKKVDNIDVLAIQGQYEYSAPDGTPVKFTYT 116 T++ P+ G S +G +A +G + +L + YE P GT +K T Sbjct: 1498 TDLEPESGVSEAPPGTDGAAAAPTGGAAVTNATSILQVYAAYETGLPSGTSLKLRVT 1554 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 25.0 bits (52), Expect = 1.1 Identities = 10/38 (26%), Positives = 18/38 (47%) Query: 99 GQYEYSAPDGTPVKFTYTADENGYQPQSELLPVAPPMP 136 G Y+ + DG P+ + G++PQ+ P+P Sbjct: 28 GMYDNISNDGIPMDALAELQDTGFEPQTRARSNTWPLP 65 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 4.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 123 QPQSELLPVAPPMPEAIRR 141 Q Q+E LP PP P RR Sbjct: 1072 QRQAERLPPPPPSPRTERR 1090 >Y17699-1|CAA76819.1| 81|Anopheles gambiae hypothetical protein protein. Length = 81 Score = 22.6 bits (46), Expect = 6.1 Identities = 9/14 (64%), Positives = 11/14 (78%) Query: 1 MKFLVLALCVCAVS 14 MKFL +AL VC +S Sbjct: 1 MKFLTIALLVCLLS 14 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 119 ADTVRDPRGFAVKFYTDDGV 138 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 124 PQSELLPVAPPMPEAIR 140 PQ+ LLPV P P+ + Sbjct: 141 PQTTLLPVTPEKPKLFK 157 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 59 SDTEVNPDGFSFGYETDNGI 78 +DT +P GF+ + TD+G+ Sbjct: 103 ADTVRDPRGFAVKFYTDDGV 122 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.315 0.134 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,717 Number of Sequences: 2123 Number of extensions: 5774 Number of successful extensions: 21 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 20 length of query: 159 length of database: 516,269 effective HSP length: 59 effective length of query: 100 effective length of database: 391,012 effective search space: 39101200 effective search space used: 39101200 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -