BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000328-TA|BGIBMGA000328-PA|IPR000618|Insect cuticle protein (159 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 103 6e-25 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 103 bits (248), Expect = 6e-25 Identities = 51/107 (47%), Positives = 67/107 (62%), Gaps = 1/107 (0%) Query: 49 GSEADAVILRSDTEVNPDG-FSFGYETDNGISAQSSGSLKKVDNIDVLAIQGQYEYSAPD 107 G++ DAVI EVN DG + +ET NGIS Q SG K+VDN + QG Y+APD Sbjct: 22 GADKDAVITSQQLEVNFDGNYINNFETSNGISHQESGQPKQVDNETPVVSQGSDSYTAPD 81 Query: 108 GTPVKFTYTADENGYQPQSELLPVAPPMPEAIRRAIDYILAHPPKTE 154 G V TY ADENG+Q Q +P APP+P I+RA+++ AHP + + Sbjct: 82 GQQVSITYVADENGFQVQGSHIPTAPPIPPEIQRALEWNAAHPEEDD 128 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.315 0.134 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,827 Number of Sequences: 429 Number of extensions: 1825 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 159 length of database: 140,377 effective HSP length: 53 effective length of query: 106 effective length of database: 117,640 effective search space: 12469840 effective search space used: 12469840 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -