BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000327-TA|BGIBMGA000327-PA|IPR000618|Insect cuticle protein (131 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0152 - 1211859-1211903,1212247-1212443,1213469-1213532,121... 33 0.057 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 31 0.23 07_03_0172 + 14697741-14697869,14697878-14697998,14698134-146982... 31 0.40 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 30 0.70 08_02_1012 + 23550314-23551504 29 0.92 03_05_0780 + 27646936-27647084,27647168-27647289,27649380-276494... 29 0.92 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 29 1.2 03_01_0085 + 690618-691012,691114-691193,691775-691959,692363-69... 29 1.2 12_01_0173 - 1292164-1293036,1294063-1294098,1294195-1294334,129... 29 1.6 06_01_0944 + 7264833-7265120,7265511-7265600,7265702-7265798,726... 29 1.6 04_04_0662 - 27051508-27051828,27051878-27053438,27054333-27054733 29 1.6 01_01_0077 - 585670-585787,585921-586687 29 1.6 07_03_0624 + 20044406-20044756,20045168-20045221 28 2.1 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 28 2.1 01_07_0081 - 40959279-40959375,40959463-40959589,40960138-409603... 28 2.1 09_06_0137 - 21080263-21081894 28 2.8 07_03_0890 - 22332768-22333382 28 2.8 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 28 2.8 01_01_0884 - 6956337-6956431,6956514-6957651 28 2.8 06_03_0730 - 23948801-23949079,23949528-23949588,23949828-239499... 27 3.7 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 27 4.9 07_01_0838 - 6811525-6812364,6813085-6813211,6813321-6813670 27 4.9 02_05_1277 - 35408097-35409080 27 4.9 02_04_0221 - 21021886-21022144,21022227-21022345,21022681-210229... 27 4.9 02_04_0019 - 18951037-18951180,18951939-18952403 27 4.9 06_03_1310 + 29238644-29240260 27 6.5 06_03_0930 - 26038341-26038508,26039114-26039254,26040799-260408... 27 6.5 06_01_0817 - 6185881-6187074 27 6.5 04_04_0323 - 24392043-24393021,24393135-24393544 27 6.5 03_05_0010 + 19622430-19622512,19622539-19623082,19623361-196237... 27 6.5 02_05_0315 - 27822379-27823899 27 6.5 02_02_0529 - 11208973-11211143,11211703-11211772,11211993-112120... 27 6.5 01_05_0423 + 22032940-22033695 27 6.5 01_01_0505 - 3695937-3695972,3696251-3696316,3696658-3696747,369... 27 6.5 10_07_0107 - 12936839-12937030,12937305-12937386,12937476-129375... 26 8.6 09_04_0506 - 18188785-18190599 26 8.6 06_03_0178 + 17594062-17595576 26 8.6 04_04_1466 - 33799104-33799229,33799659-33799669,33800052-338002... 26 8.6 >03_01_0152 - 1211859-1211903,1212247-1212443,1213469-1213532, 1213630-1213802,1213889-1214075 Length = 221 Score = 33.5 bits (73), Expect = 0.057 Identities = 14/24 (58%), Positives = 17/24 (70%) Query: 103 PTPPPIPEVIQRALAYLATAPPQP 126 PTPPP+ +RALA A APP+P Sbjct: 33 PTPPPLAAPSRRALAVRAMAPPKP 56 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 31.5 bits (68), Expect = 0.23 Identities = 25/114 (21%), Positives = 44/114 (38%), Gaps = 7/114 (6%) Query: 22 TEPIPILKQESSIEPDGSYQYSYETGNGISAAERGALK----NIGAEEPALQVEGQFQYP 77 TE ++K+++ E +Y +GI + R AL I + P E Q Sbjct: 820 TEREKVIKEKA--EKARVQRYGGVNSSGIVPSPRSALPPKLAQIKEKAPTANAESSDQPS 877 Query: 78 SEDGGTIQLSYIANENGFQPQGSHLPTPPPIPEVIQRALAYLATAPPQPENNRP 131 + ++ + N + + +P PPP P + L+ PP+P P Sbjct: 878 DNQNNPLVVTQLKLAN-IEKRAPRVPRPPPAPSATANTASALSPPPPRPPGAPP 930 >07_03_0172 + 14697741-14697869,14697878-14697998,14698134-14698226, 14700888-14700946,14701003-14701599,14702813-14703020, 14703102-14703178,14703263-14703302,14703413-14703473, 14704120-14704189,14705014-14705235 Length = 558 Score = 30.7 bits (66), Expect = 0.40 Identities = 21/104 (20%), Positives = 42/104 (40%), Gaps = 4/104 (3%) Query: 24 PIPILKQESSIEP-DGSYQYSYETGNGISAAERGALKNIGAEEPALQVEGQFQYPSEDGG 82 P+P + +S++ P G +Q S + + +++ ++ + E P G Sbjct: 184 PMPPHQNQSTVAPLHGHFQSSTGSVGPLRSSQAIRFSSVSSNEQYTNANPYNSQPPSSGS 243 Query: 83 TIQLSYIANENGFQPQGSHLPT---PPPIPEVIQRALAYLATAP 123 + L+Y + GF+P + P P P+ + L Y P Sbjct: 244 SSTLNYGSQYGGFEPSLTDFPRDAGPTWCPDPVDGLLGYTDDVP 287 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 29.9 bits (64), Expect = 0.70 Identities = 21/95 (22%), Positives = 34/95 (35%), Gaps = 5/95 (5%) Query: 41 QYSYETGNGISAAERGALK----NIGAEEPALQVEGQFQYPSEDGGTIQLSYIANENGFQ 96 +Y +GI + R AL I + P E Q + ++ + N + Sbjct: 532 RYGGVNSSGIVPSPRSALPPKLAQIKEKAPTANAESSDQPSDNQNNPLVVTQLKLAN-IE 590 Query: 97 PQGSHLPTPPPIPEVIQRALAYLATAPPQPENNRP 131 + +P PPP P + L PP+P P Sbjct: 591 KRAPRVPRPPPAPSATANTASALPPPPPRPPGAPP 625 >08_02_1012 + 23550314-23551504 Length = 396 Score = 29.5 bits (63), Expect = 0.92 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Query: 96 QPQGSHLPTPPPIPEVIQRALAYLATAPPQPENNRP 131 QP+ +PPP+P + A A ++T P +P+ RP Sbjct: 166 QPRSPRPASPPPVPAAPEVASA-VSTPPARPKRGRP 200 >03_05_0780 + 27646936-27647084,27647168-27647289,27649380-27649458, 27650346-27650427,27650483-27650600,27650695-27651050, 27651404-27652222,27652846-27653265,27653426-27653437 Length = 718 Score = 29.5 bits (63), Expect = 0.92 Identities = 12/29 (41%), Positives = 14/29 (48%) Query: 103 PTPPPIPEVIQRALAYLATAPPQPENNRP 131 P PPP A +LA + PQP RP Sbjct: 463 PRPPPTTTTAAAANGHLAASQPQPHRRRP 491 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 29.1 bits (62), Expect = 1.2 Identities = 19/61 (31%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 67 ALQVEGQFQYPSEDGGTIQLSYIANENGFQPQGSH-LPTPPPIPEVIQRALAYLATAPPQ 125 AL E + + P+ LS ++ + P P PPP P A A A APP Sbjct: 121 ALLAESEDEIPAAQSKAASLSSSSSSSPPPPPPQESTPPPPPPPPPAPVAAAVSAPAPPS 180 Query: 126 P 126 P Sbjct: 181 P 181 >03_01_0085 + 690618-691012,691114-691193,691775-691959,692363-693320, 693391-693518,693951-694010,694113-694163,694704-694821, 694990-695915,695916-697707,697810-697943,698029-698526 Length = 1774 Score = 29.1 bits (62), Expect = 1.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Query: 96 QPQGSHLPTPPPIPEVIQRALAYLATAPPQPEN 128 Q G P+PPPIPE I+ + A P+N Sbjct: 1196 QDNGHEYPSPPPIPESIELSPHSKALPESSPDN 1228 >12_01_0173 - 1292164-1293036,1294063-1294098,1294195-1294334, 1295592-1295748,1295862-1296035,1296146-1296396, 1299446-1299590 Length = 591 Score = 28.7 bits (61), Expect = 1.6 Identities = 21/80 (26%), Positives = 30/80 (37%), Gaps = 10/80 (12%) Query: 56 GALKNIGAEEP---ALQVEGQFQYPSEDGGTIQLSYIANENGFQPQG------SHLPTPP 106 GA +G +P A Q G F P + ++ N G G P PP Sbjct: 461 GATAALGGTQPPTQANQAAGSFP-PPPPPLPLMPQFVQNTGGMFGMGPFGMVSGSAPPPP 519 Query: 107 PIPEVIQRALAYLATAPPQP 126 P+P ++ L+ PP P Sbjct: 520 PLPNIMSAGFPRLSVPPPLP 539 >06_01_0944 + 7264833-7265120,7265511-7265600,7265702-7265798, 7265927-7265988,7266508-7266596,7266702-7266822, 7266915-7267058,7267492-7267820,7268154-7268394, 7269042-7269245,7271150-7271619,7272703-7272746, 7273121-7273211,7273494-7273596,7273682-7273783, 7274214-7274300,7274421-7274531 Length = 890 Score = 28.7 bits (61), Expect = 1.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 99 GSHLPTPPPIPEVIQRALAYLATAPP 124 GS P+P +PE+++ A+ AT PP Sbjct: 641 GSTSPSPDVLPEILRHAVPIKATPPP 666 >04_04_0662 - 27051508-27051828,27051878-27053438,27054333-27054733 Length = 760 Score = 28.7 bits (61), Expect = 1.6 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 96 QPQGSHLPTP-PPIPEVIQRALAYLATAPPQPEN 128 QP H P P PP P+ A L PPQP++ Sbjct: 410 QPARQHQPQPTPPPPQAAPIPAAPLQQQPPQPQH 443 >01_01_0077 - 585670-585787,585921-586687 Length = 294 Score = 28.7 bits (61), Expect = 1.6 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Query: 96 QPQGSHLPTPPPIPEVIQRALAYLATAP 123 QP H P PPP P++ +RA +A AP Sbjct: 18 QPHNHHPPVPPP-PKLGRRAALAIAAAP 44 >07_03_0624 + 20044406-20044756,20045168-20045221 Length = 134 Score = 28.3 bits (60), Expect = 2.1 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 6/36 (16%) Query: 78 SEDGGTIQLSYIANENGFQPQGSHLPTP---PPIPE 110 ++DGG +A E+G Q + SHLP P PPIP+ Sbjct: 36 ADDGGGRS---VAEEDGGQRRRSHLPDPAGGPPIPD 68 >05_06_0026 - 25024807-25025300,25025432-25025495,25025567-25025662, 25025719-25025929,25026616-25026690,25026820-25027037 Length = 385 Score = 28.3 bits (60), Expect = 2.1 Identities = 12/30 (40%), Positives = 15/30 (50%) Query: 97 PQGSHLPTPPPIPEVIQRALAYLATAPPQP 126 P +P PPP P + A A + PPQP Sbjct: 20 PPPVQVPVPPPPPPPLPPAAAAVEPLPPQP 49 >01_07_0081 - 40959279-40959375,40959463-40959589,40960138-40960339, 40962414-40963361 Length = 457 Score = 28.3 bits (60), Expect = 2.1 Identities = 24/86 (27%), Positives = 35/86 (40%), Gaps = 5/86 (5%) Query: 42 YSYETGNGISAAERGALKNIGAEEPALQVEGQFQY--PSEDGGTIQLSYIANENGFQPQG 99 Y+ GN + RGA + AE +L QY S D GTI + + G Sbjct: 306 YNAAEGNLLQEVRRGADR---AEIYSLAFSNNLQYLAVSSDKGTIHVFNLKINVGLTTND 362 Query: 100 SHLPTPPPIPEVIQRALAYLATAPPQ 125 LP P P I +L+++ P+ Sbjct: 363 KPLPAPDPDVPHISPSLSFIKGVLPK 388 >09_06_0137 - 21080263-21081894 Length = 543 Score = 27.9 bits (59), Expect = 2.8 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 97 PQGSHLPTPPPIPEVIQRALAYLATAPPQPE 127 P + P+ PP+PE + AL+ L +PP P+ Sbjct: 77 PVPATAPSEPPLPE-LSSALSGLLASPPSPQ 106 >07_03_0890 - 22332768-22333382 Length = 204 Score = 27.9 bits (59), Expect = 2.8 Identities = 12/30 (40%), Positives = 14/30 (46%) Query: 97 PQGSHLPTPPPIPEVIQRALAYLATAPPQP 126 P P PPP P +RA+ A PP P Sbjct: 78 PPAEATPPPPPPPPPPERAVPEAADTPPPP 107 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 27.9 bits (59), Expect = 2.8 Identities = 20/76 (26%), Positives = 30/76 (39%), Gaps = 5/76 (6%) Query: 51 SAAERGALKNIGAEEPALQVEGQFQYPSEDGGTIQLSYIANENGFQPQGSHLPTPPPIPE 110 SA+ R +L + A P+ Y T+ +P+ S LP PP P Sbjct: 223 SASSRVSLPSTSAPSPSSSTSTSPTYSCSSSDTV-----TTPRNRKPELSKLPPIPPPPP 277 Query: 111 VIQRALAYLATAPPQP 126 + ++ A APP P Sbjct: 278 MPALSVCGRAAAPPPP 293 >01_01_0884 - 6956337-6956431,6956514-6957651 Length = 410 Score = 27.9 bits (59), Expect = 2.8 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Query: 92 ENGFQPQGSHLPTPPPIPEVIQ----RALAYLATAPPQP 126 E +P S P+P P P Q A A +A APPQP Sbjct: 258 ETDLEPDPSPSPSPSPSPAPTQPPTAAAAAAVAPAPPQP 296 >06_03_0730 - 23948801-23949079,23949528-23949588,23949828-23949954, 23950449-23950485,23950987-23951061,23951489-23951598, 23952700-23952754,23952833-23952949,23953201-23953355, 23953577-23953634,23954239-23954460 Length = 431 Score = 27.5 bits (58), Expect = 3.7 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Query: 81 GGTIQLSYIANENGFQPQGSHLPTPPPIPEVIQRALAYLATAPPQPENNR 130 G T +Y ++ G P+ + P PPP P++++ + +A A +++R Sbjct: 381 GATEGSNYRSDHFGASPRSALAPPPPPSPDLVE--IVSVAAADDDGDDSR 428 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 27.1 bits (57), Expect = 4.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Query: 103 PTPPPIPEVIQRALAYLATAPPQP 126 P PPP+P A A APP P Sbjct: 272 PPPPPMPPRTDNASTQAAPAPPPP 295 >07_01_0838 - 6811525-6812364,6813085-6813211,6813321-6813670 Length = 438 Score = 27.1 bits (57), Expect = 4.9 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Query: 36 PDGSYQYSYETGNGISAAERGALKNIGAEEPALQVEGQFQYPSEDGGTIQLS 87 P+G + Y E G S A G+ + + QF PSED G + L+ Sbjct: 385 PNGGH-YGEEAGPS-SVATGGSANGMDDNDVVQMASNQFMMPSEDEGILDLA 434 >02_05_1277 - 35408097-35409080 Length = 327 Score = 27.1 bits (57), Expect = 4.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Query: 103 PTPPPIPEVIQRALAYLATAPPQPE 127 P PPP P LA A APP P+ Sbjct: 60 PAPPPPPPAQPPVLAAPAPAPPPPQ 84 >02_04_0221 - 21021886-21022144,21022227-21022345,21022681-21022920, 21023064-21023171,21023272-21023331,21023991-21024066, 21024155-21024360,21024722-21024784,21024925-21025012, 21025515-21026015,21027206-21027603 Length = 705 Score = 27.1 bits (57), Expect = 4.9 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Query: 97 PQGSH--LPTPPPIPEVIQRALAYLATAPPQP 126 PQ H LP P P+ + LA A APP P Sbjct: 74 PQDQHHGLPLPRPVSKSAPMPLASPAAAPPSP 105 >02_04_0019 - 18951037-18951180,18951939-18952403 Length = 202 Score = 27.1 bits (57), Expect = 4.9 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 5/78 (6%) Query: 49 GISAAERGALKNIGAEEPALQVEGQFQYPSEDGGTIQLSYIANE-NGFQPQGSH--LPTP 105 GI+ A + LK I E L+ QY +D T L+YI E N + + Sbjct: 93 GIALAIQWTLKPIVVESDCLEAVRMLQYAEKDLST--LAYIIREINALMSRNREIVIQKS 150 Query: 106 PPIPEVIQRALAYLATAP 123 P + + + LA LA +P Sbjct: 151 PVVKIAMAQGLAQLAMSP 168 >06_03_1310 + 29238644-29240260 Length = 538 Score = 26.6 bits (56), Expect = 6.5 Identities = 12/35 (34%), Positives = 16/35 (45%) Query: 97 PQGSHLPTPPPIPEVIQRALAYLATAPPQPENNRP 131 P SHLP PPP ++ +T+PP P Sbjct: 404 PTPSHLPPPPPTYSESPKSSMPPSTSPPSSHGASP 438 >06_03_0930 - 26038341-26038508,26039114-26039254,26040799-26040858, 26040972-26041034,26041444-26041454,26041722-26041802, 26042783-26043020,26043563-26043997 Length = 398 Score = 26.6 bits (56), Expect = 6.5 Identities = 12/28 (42%), Positives = 14/28 (50%) Query: 99 GSHLPTPPPIPEVIQRALAYLATAPPQP 126 G+ PPP P V+ A A TA P P Sbjct: 114 GAFCSPPPPPPPVVTAAAATTPTAAPTP 141 >06_01_0817 - 6185881-6187074 Length = 397 Score = 26.6 bits (56), Expect = 6.5 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 5/34 (14%) Query: 102 LPTPP-PIP----EVIQRALAYLATAPPQPENNR 130 LP+PP P+ E+I A++A+ PP P N+R Sbjct: 139 LPSPPSPVVSALLELISALSAFVASTPPLPHNSR 172 >04_04_0323 - 24392043-24393021,24393135-24393544 Length = 462 Score = 26.6 bits (56), Expect = 6.5 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Query: 100 SHLPTPPPIPEVIQRALAYLATAPP--QPENNR 130 + LPTPPP PE +A PP P NR Sbjct: 182 TRLPTPPPPPEEQDATIADSMPEPPPSSPSPNR 214 >03_05_0010 + 19622430-19622512,19622539-19623082,19623361-19623767, 19623831-19624167,19624290-19624508,19625522-19625826, 19626128-19626287,19626422-19626547 Length = 726 Score = 26.6 bits (56), Expect = 6.5 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Query: 88 YIANENGFQPQGS---HLPTPPPIPEVIQRALAYLATAPPQP 126 Y+ N NG+ PQG + P P I E I PP P Sbjct: 184 YMGNINGYHPQGDQGRNQPRPRTIKEAITTRGGKSTRDPPYP 225 >02_05_0315 - 27822379-27823899 Length = 506 Score = 26.6 bits (56), Expect = 6.5 Identities = 10/27 (37%), Positives = 14/27 (51%) Query: 83 TIQLSYIANENGFQPQGSHLPTPPPIP 109 ++ LS ++ P S L TPPP P Sbjct: 59 SVSLSQLSTTRNHTPSSSSLSTPPPAP 85 >02_02_0529 - 11208973-11211143,11211703-11211772,11211993-11212049, 11212769-11212819,11213112-11213264,11216095-11216255, 11216609-11216642 Length = 898 Score = 26.6 bits (56), Expect = 6.5 Identities = 24/92 (26%), Positives = 37/92 (40%), Gaps = 6/92 (6%) Query: 41 QYSYETGNGISAAERGALKNIGAEEPALQVEGQFQYPSEDGGTIQLSYIANENGFQPQGS 100 QY++ N + E G L++ + G +YPS G + +Y + Q G+ Sbjct: 20 QYAFFGNNAVEEVELGGLEDDDGIDAGFVGPGDEEYPSAYGRDMFENYKKTDAIRQRHGT 79 Query: 101 ---HLPTPPP---IPEVIQRALAYLATAPPQP 126 H T P PEV+ +AT P P Sbjct: 80 GTIHTDTAGPNTQRPEVLLLFSTPIATTAPFP 111 >01_05_0423 + 22032940-22033695 Length = 251 Score = 26.6 bits (56), Expect = 6.5 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Query: 99 GSHLPTPPPIPEVIQRALAYLATAPP 124 G LP+PPP P+ Q+ L +L PP Sbjct: 162 GGFLPSPPPPPQG-QQQLLFLPPPPP 186 >01_01_0505 - 3695937-3695972,3696251-3696316,3696658-3696747, 3696934-3697143,3697371-3697404,3697566-3697912 Length = 260 Score = 26.6 bits (56), Expect = 6.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 38 GSYQYSYETGNGISAAERG 56 G YQYSY+ G+ S A+ G Sbjct: 136 GCYQYSYKNGDNRSGADHG 154 >10_07_0107 - 12936839-12937030,12937305-12937386,12937476-12937586, 12937667-12937918,12938004-12940237,12940328-12940525 Length = 1022 Score = 26.2 bits (55), Expect = 8.6 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Query: 97 PQGSHLPTPPPIPEVIQRALAYLATAPPQPENNRP 131 P HLP+PPP+ R+ T PP P P Sbjct: 577 PSPRHLPSPPPL-----RSPPRQPTPPPSPSQQPP 606 >09_04_0506 - 18188785-18190599 Length = 604 Score = 26.2 bits (55), Expect = 8.6 Identities = 12/36 (33%), Positives = 16/36 (44%) Query: 96 QPQGSHLPTPPPIPEVIQRALAYLATAPPQPENNRP 131 QP P PPP + Q+ L + PP P +P Sbjct: 70 QPPPLQAPPPPPQQQQQQQQLQAPPSLPPPPPQRQP 105 >06_03_0178 + 17594062-17595576 Length = 504 Score = 26.2 bits (55), Expect = 8.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Query: 96 QPQGSHLPTPPPIPEVIQRALAYLATAPPQP 126 Q QG +PTP P R+ ++LAT P Sbjct: 117 QRQGGPVPTPTPATSTALRSPSFLATPSVAP 147 >04_04_1466 - 33799104-33799229,33799659-33799669,33800052-33800200, 33800261-33800299,33800690-33800746,33800839-33801628, 33801705-33801980,33802051-33802117,33802211-33802285, 33802618-33802812,33802927-33803076,33803152-33803522, 33804070-33804193,33804246-33804275,33804306-33804417, 33804919-33804985,33805138-33805180,33805768-33805872 Length = 928 Score = 26.2 bits (55), Expect = 8.6 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Query: 44 YETGNGISAAERGAL----KNIGAEEPALQVEGQFQYPSEDG-GTIQLSYIANENGFQPQ 98 +++G + A+ G L KN G+ A + E + YPS G G + Y +++ P Sbjct: 120 FQSGAEDNIADGGPLAPPAKNFGSFPSAYEQEVSYNYPSTPGVGNAMIQYPSSQTQLPPT 179 Query: 99 GS 100 S Sbjct: 180 AS 181 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.310 0.132 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,821,859 Number of Sequences: 37544 Number of extensions: 240538 Number of successful extensions: 851 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 17 Number of HSP's that attempted gapping in prelim test: 818 Number of HSP's gapped (non-prelim): 49 length of query: 131 length of database: 14,793,348 effective HSP length: 74 effective length of query: 57 effective length of database: 12,015,092 effective search space: 684860244 effective search space used: 684860244 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -