BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000326-TA|BGIBMGA000326-PA|IPR000618|Insect cuticle protein (131 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 23 1.2 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 2.1 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 3.7 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 4.9 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.6 bits (46), Expect = 1.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 58 LKKVGDVEALEVQGEFKYPGENGQ 81 L+KVGD + F+ P ENG+ Sbjct: 351 LRKVGDPSKRKGTYAFRTPDENGE 374 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 2.1 Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 85 LTYTADENGFHPSGSHLPTSPPIPEA 110 L YT+ +G + H T +PEA Sbjct: 1178 LAYTSGGDGVRTTPIHCQTEQDVPEA 1203 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 3.7 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Query: 18 PQGPTEPIPIVRDDSQI--NGDGSYQYAF 44 PQ P + + DDS + +GD Y+ F Sbjct: 651 PQNPDNDVHSIVDDSDVGPSGDCFYENKF 679 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 20.6 bits (41), Expect = 4.9 Identities = 8/31 (25%), Positives = 16/31 (51%) Query: 70 QGEFKYPGENGQDISLTYTADENGFHPSGSH 100 QG + P ++++ +G+HPS S+ Sbjct: 136 QGFAQQPMFPSMSVNVSMNMTMHGYHPSSSY 166 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.310 0.135 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,530 Number of Sequences: 317 Number of extensions: 1080 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 131 length of database: 114,650 effective HSP length: 51 effective length of query: 80 effective length of database: 98,483 effective search space: 7878640 effective search space used: 7878640 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.3 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -