BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000324-TA|BGIBMGA000324-PA|IPR000618|Insect cuticle protein (114 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 30 0.024 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 30 0.024 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 30 0.024 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 30 0.024 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 30 0.024 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 30 0.024 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 30 0.024 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 30 0.024 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 30 0.024 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 30 0.024 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 30 0.024 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 30 0.024 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 29 0.031 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 28 0.072 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 91 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 146 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 91 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 146 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 115 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 170 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 91 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 146 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 83 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 91 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 146 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 29.9 bits (64), Expect = 0.024 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 83 NYEFSYSVHDEHTGDIKNQHETRHGDEV----HGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 29.5 bits (63), Expect = 0.031 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 43 NFETSNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFAD-ETGYHA 101 N+E S + TG++K + + V G YS ++DG + Y AD TG++A Sbjct: 91 NYEFSYSVHDEHTGDIKSQHETRHGDEV----HGQYSLLDSDGHHRIVDYHADHHTGFNA 146 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 28.3 bits (60), Expect = 0.072 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Query: 74 VRGSYSYTNTDGKPETITYFAD-ETGYHA 101 V+GSYS + DG T+ Y AD G++A Sbjct: 49 VQGSYSVVDPDGTKRTVDYTADPHNGFNA 77 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.307 0.128 0.362 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,108 Number of Sequences: 2123 Number of extensions: 4646 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of query: 114 length of database: 516,269 effective HSP length: 56 effective length of query: 58 effective length of database: 397,381 effective search space: 23048098 effective search space used: 23048098 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -