BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000321-TA|BGIBMGA000321-PA|IPR009053|Prefoldin (356 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 0.76 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 25 1.00 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 25 1.00 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 25 1.00 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 25 1.00 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 24 1.7 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 24 1.7 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 24 1.7 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 24 1.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 2.3 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 24 2.3 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 3.0 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 3.0 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 3.0 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 3.0 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 4.0 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 23 5.3 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 23 5.3 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 23 5.3 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 23 5.3 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 23 5.3 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 23 5.3 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 23 5.3 AY569719-1|AAS86672.1| 401|Apis mellifera complementary sex det... 23 5.3 AY569718-1|AAS86671.1| 401|Apis mellifera complementary sex det... 23 5.3 AY569715-1|AAS86668.1| 401|Apis mellifera complementary sex det... 23 5.3 AY569714-1|AAS86667.1| 401|Apis mellifera complementary sex det... 23 5.3 AY569713-1|AAS86666.1| 401|Apis mellifera complementary sex det... 23 5.3 AY569711-1|AAS86664.1| 401|Apis mellifera complementary sex det... 23 5.3 AY569702-1|AAS86655.1| 400|Apis mellifera complementary sex det... 23 5.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 5.3 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 7.0 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 7.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 7.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 7.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 7.0 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 22 7.0 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 9.3 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 9.3 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 9.3 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 22 9.3 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 22 9.3 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 22 9.3 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 22 9.3 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 22 9.3 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 22 9.3 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 22 9.3 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 22 9.3 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 22 9.3 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.4 bits (53), Expect = 0.76 Identities = 21/95 (22%), Positives = 42/95 (44%), Gaps = 1/95 (1%) Query: 32 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 91 +I +++Q+ VL V ++ K + SLR + Q + + S + + + Sbjct: 185 KINKIEEQDTVLVVNIEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 92 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 126 KK+++ H E+ E+ L SRK +E+ Sbjct: 245 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 278 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 1.00 Identities = 15/71 (21%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 117 ++ NR R+ + ++E+++ +K + +E+E ++ ERE + SR Sbjct: 6 RDRNREYRKKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYR-EYRETSR 64 Query: 118 KLNQLRQEKCR 128 + ++ R+E+ R Sbjct: 65 ERSRDRKERER 75 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 1.00 Identities = 15/71 (21%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 117 ++ NR R+ + ++E+++ +K + +E+E ++ ERE + SR Sbjct: 6 RDRNREYRKKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYR-EYRETSR 64 Query: 118 KLNQLRQEKCR 128 + ++ R+E+ R Sbjct: 65 ERSRDRKERER 75 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 1.00 Identities = 15/71 (21%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 117 ++ NR R+ + ++E+++ +K + +E+E ++ ERE + SR Sbjct: 6 RDRNREYRKKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYR-EYRETSR 64 Query: 118 KLNQLRQEKCR 128 + ++ R+E+ R Sbjct: 65 ERSRDRKERER 75 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 1.00 Identities = 15/71 (21%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 117 ++ NR R+ + ++E+++ +K + +E+E ++ ERE + SR Sbjct: 6 RDRNREYRKKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYR-EYRETSR 64 Query: 118 KLNQLRQEKCR 128 + ++ R+E+ R Sbjct: 65 ERSRDRKERER 75 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.7 Identities = 11/50 (22%), Positives = 24/50 (48%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE 107 ++ NR R+ + +EE+ + +K + +E+E ++ ERE Sbjct: 6 RDRNREYRKKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNERE 55 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.7 Identities = 11/50 (22%), Positives = 24/50 (48%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE 107 ++ NR R+ + +EE+ + +K + +E+E ++ ERE Sbjct: 6 RDRNREYRKKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNERE 55 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.7 Identities = 11/50 (22%), Positives = 24/50 (48%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE 107 ++ NR R+ + +EE+ + +K + +E+E ++ ERE Sbjct: 6 RDRNREYRKKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNERE 55 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.7 Identities = 11/50 (22%), Positives = 24/50 (48%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE 107 ++ NR R+ + +EE+ + +K + +E+E ++ ERE Sbjct: 6 RDRNREYRKKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNERE 55 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 2.3 Identities = 20/95 (21%), Positives = 42/95 (44%), Gaps = 1/95 (1%) Query: 32 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 91 +I +++ + VL V ++ + K + SLR + Q + + S + + + Sbjct: 174 KINKIKEHDTVLVVNIEKSENESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 233 Query: 92 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 126 KK+++ H E+ E+ L SRK +E+ Sbjct: 234 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 267 Score = 22.6 bits (46), Expect = 5.3 Identities = 13/73 (17%), Positives = 30/73 (41%) Query: 35 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALK 94 SL+ + + Y ++ NR R+ + ++E+ + +K + Sbjct: 205 SLRNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRS 264 Query: 95 KEKETLAHHYERE 107 +E+E ++ ERE Sbjct: 265 REREQKSYKNERE 277 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.8 bits (49), Expect = 2.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Query: 38 QQNRVLKVELDTYKLRVKALQEENRSL 64 QQ+ LK+ LD +L+ K L+E R L Sbjct: 358 QQSVELKLALDQEQLKSKKLEESMRKL 384 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.4 bits (48), Expect = 3.0 Identities = 21/87 (24%), Positives = 37/87 (42%), Gaps = 8/87 (9%) Query: 60 ENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKL 119 ENR L++ ++ I AK +N L+ I +K K+ ++ YER+ +S K Sbjct: 329 ENRPLKRRNIEIVAK--------NNDTLQFISGIKIIKQISSNIYERQNNEYIWIVSNKY 380 Query: 120 NQLRQEKCRXXXXXXXXXXXXVNKLMR 146 ++ VN+L+R Sbjct: 381 QKIANGDLNFNEVNFRILNAPVNQLIR 407 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.4 bits (48), Expect = 3.0 Identities = 20/95 (21%), Positives = 41/95 (43%), Gaps = 1/95 (1%) Query: 32 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 91 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 174 KINKIEEHDTVLVVNIEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 233 Query: 92 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 126 KK+++ H E+ E+ L SRK +E+ Sbjct: 234 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 267 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 3.0 Identities = 20/95 (21%), Positives = 41/95 (43%), Gaps = 1/95 (1%) Query: 32 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 91 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 185 KINKIEEHDTVLVVNIEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 92 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 126 KK+++ H E+ E+ L SRK +E+ Sbjct: 245 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 278 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.4 bits (48), Expect = 3.0 Identities = 20/95 (21%), Positives = 41/95 (43%), Gaps = 1/95 (1%) Query: 32 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 91 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 174 KINKIEEHDTVLVVNIEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNRE 233 Query: 92 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 126 KK+++ H E+ E+ L SRK +E+ Sbjct: 234 YRKKDRQYEKLHNEK-EKLLEERTSRKRYSRSRER 267 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 4.0 Identities = 13/73 (17%), Positives = 30/73 (41%) Query: 35 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALK 94 SL+ + + Y ++ NR R+ + ++E+++ K + Sbjct: 216 SLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSHKRYSRS 275 Query: 95 KEKETLAHHYERE 107 +E+E ++ ERE Sbjct: 276 REREQKSYKNERE 288 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 25 VEEKHLRERTSRRRYSRSREREQK 48 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 25 VEEKHLRERTSRRRYSRSREREQK 48 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 25 VEEKHLRERTSRRRYSRSREREQK 48 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 25 VEEKHLRERTSRRRYSRSREREQK 48 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 25 VEEKHLRERTSRRRYSRSREREQK 48 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 25 VEEKHLRERTSRRRYSRSREREQK 48 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 25 VEEKHLRERTSRRRYSRSREREQK 48 >AY569719-1|AAS86672.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 274 VEEKHLRERTSRRRYSRSREREQK 297 >AY569718-1|AAS86671.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 274 VEEKHLRERTSRRRYSRSREREQK 297 >AY569715-1|AAS86668.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 274 VEEKHLRERTSRRRYSRSREREQK 297 >AY569714-1|AAS86667.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 274 VEEKHLRERTSRRRYSRSREREQK 297 >AY569713-1|AAS86666.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 274 VEEKHLRERTSRRRYSRSREREQK 297 >AY569711-1|AAS86664.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 274 VEEKHLRERTSRRRYSRSREREQK 297 >AY569702-1|AAS86655.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 273 VEEKHLRERTSRRRYSRSREREQK 296 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 261 LEEKHIREENMRLQRKLQQEVERR 284 +EEKH+RE R + +E E++ Sbjct: 274 VEEKHLRERTSRRRYSRSREREQK 297 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 7.0 Identities = 13/73 (17%), Positives = 30/73 (41%) Query: 35 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALK 94 SL+ + + Y ++ NR R+ + ++E+ + +K + Sbjct: 205 SLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRS 264 Query: 95 KEKETLAHHYERE 107 +E+E ++ ERE Sbjct: 265 REREQNSYKNERE 277 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 7.0 Identities = 13/73 (17%), Positives = 30/73 (41%) Query: 35 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALK 94 SL+ + + Y ++ NR R+ + ++E+ + +K + Sbjct: 216 SLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRS 275 Query: 95 KEKETLAHHYERE 107 +E+E ++ ERE Sbjct: 276 REREQNSYKNERE 288 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 7.0 Identities = 20/95 (21%), Positives = 41/95 (43%), Gaps = 1/95 (1%) Query: 32 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 91 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 185 KINKIKEHDTVLVVNIEKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 92 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 126 KK+++ H E+ E+ L SRK +E+ Sbjct: 245 YRKKDRQYEKLHNEK-EKFLEERTSRKRYSRSRER 278 Score = 22.2 bits (45), Expect = 7.0 Identities = 15/95 (15%), Positives = 38/95 (40%), Gaps = 1/95 (1%) Query: 35 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALK 94 SL+ + + Y ++ NR R+ + ++E+++ +K + Sbjct: 216 SLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRS 275 Query: 95 KEKETLAHHYERE-EECLTNDLSRKLNQLRQEKCR 128 +E+E + +RE + R N+ +E+ + Sbjct: 276 REREQKLYKNKREYRKYRETSKERSRNRTERERSK 310 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 7.0 Identities = 20/95 (21%), Positives = 41/95 (43%), Gaps = 1/95 (1%) Query: 32 RIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQ 91 +I +++ + VL V ++ K + SLR + Q + + S + + + Sbjct: 185 KINKIKEHDTVLVVNIEKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNRE 244 Query: 92 ALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEK 126 KK+++ H E+ E+ L SRK +E+ Sbjct: 245 YRKKDRQYEKLHNEK-EKFLEERTSRKRYSRSRER 278 Score = 22.2 bits (45), Expect = 7.0 Identities = 15/95 (15%), Positives = 38/95 (40%), Gaps = 1/95 (1%) Query: 35 SLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALK 94 SL+ + + Y ++ NR R+ + ++E+++ +K + Sbjct: 216 SLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRS 275 Query: 95 KEKETLAHHYERE-EECLTNDLSRKLNQLRQEKCR 128 +E+E + +RE + R N+ +E+ + Sbjct: 276 REREQKLYKNKREYRKYRETSKERSRNRTERERSK 310 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 7.0 Identities = 12/55 (21%), Positives = 23/55 (41%) Query: 149 EKLEAETLAKQTNXXXXXXXXXXXXNTLEQEQEALVNRLWKRMDKLEAEKRSLQI 203 ++ ++++ +N +T EAL + KR DK +K+S I Sbjct: 27 QRSSGSSISRNSNRSESSGYCGRRPSTFGSSNEALPQPISKRKDKEHKKKKSKTI 81 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 22.2 bits (45), Expect = 7.0 Identities = 12/55 (21%), Positives = 23/55 (41%) Query: 149 EKLEAETLAKQTNXXXXXXXXXXXXNTLEQEQEALVNRLWKRMDKLEAEKRSLQI 203 ++ ++++ +N +T EAL + KR DK +K+S I Sbjct: 27 QRSSGSSISRNSNRSESSGYCGRRPSTFGSSNEALPQPISKRKDKEHKKKKSKTI 81 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 9.3 Identities = 12/72 (16%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE-EECLTNDLS 116 ++ NR R+ + ++E+++ +K + +E+E + +RE + Sbjct: 6 RDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKE 65 Query: 117 RKLNQLRQEKCR 128 R N+ +E+ + Sbjct: 66 RSRNRTERERSK 77 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 9.3 Identities = 13/69 (18%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 117 ++ NR ++ + ++E+ + +K + +E+E ++ ERE + S+ Sbjct: 6 RDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYR-KYRETSK 64 Query: 118 KLNQLRQEK 126 + +Q R E+ Sbjct: 65 ERSQDRTER 73 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 9.3 Identities = 13/69 (18%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSR 117 ++ NR ++ + ++E+ + +K + +E+E ++ ERE + S+ Sbjct: 6 RDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYR-KYRETSK 64 Query: 118 KLNQLRQEK 126 + +Q R E+ Sbjct: 65 ERSQDRTER 73 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 9.3 Identities = 12/72 (16%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE-EECLTNDLS 116 ++ NR R+ + ++E+++ +K + +E+E + +RE + Sbjct: 6 RDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKE 65 Query: 117 RKLNQLRQEKCR 128 R N+ +E+ + Sbjct: 66 RSRNRTERERSK 77 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 9.3 Identities = 12/72 (16%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE-EECLTNDLS 116 ++ NR R+ + ++E+++ +K + +E+E + +RE + Sbjct: 6 RDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKE 65 Query: 117 RKLNQLRQEKCR 128 R N+ +E+ + Sbjct: 66 RSRNRTERERSK 77 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 9.3 Identities = 12/72 (16%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE-EECLTNDLS 116 ++ NR R+ + ++E+++ +K + +E+E + +RE + Sbjct: 6 RDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKE 65 Query: 117 RKLNQLRQEKCR 128 R N+ +E+ + Sbjct: 66 RSRNRTERERSK 77 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 9.3 Identities = 12/72 (16%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE-EECLTNDLS 116 ++ NR R+ + ++E+++ +K + +E+E + +RE + Sbjct: 6 RDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKE 65 Query: 117 RKLNQLRQEKCR 128 R N+ +E+ + Sbjct: 66 RSRNRTERERSK 77 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 9.3 Identities = 12/72 (16%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE-EECLTNDLS 116 ++ NR R+ + ++E+++ +K + +E+E + +RE + Sbjct: 6 RDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKE 65 Query: 117 RKLNQLRQEKCR 128 R N+ +E+ + Sbjct: 66 RSRNRTERERSK 77 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 9.3 Identities = 12/72 (16%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE-EECLTNDLS 116 ++ NR R+ + ++E+++ +K + +E+E + +RE + Sbjct: 6 RDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKE 65 Query: 117 RKLNQLRQEKCR 128 R N+ +E+ + Sbjct: 66 RSRNRTERERSK 77 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 9.3 Identities = 12/72 (16%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE-EECLTNDLS 116 ++ NR R+ + ++E+++ +K + +E+E + +RE + Sbjct: 6 RDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKE 65 Query: 117 RKLNQLRQEKCR 128 R N+ +E+ + Sbjct: 66 RSRNRTERERSK 77 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 9.3 Identities = 12/72 (16%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE-EECLTNDLS 116 ++ NR R+ + ++E+++ +K + +E+E + +RE + Sbjct: 6 RDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKE 65 Query: 117 RKLNQLRQEKCR 128 R N+ +E+ + Sbjct: 66 RSRNRTERERSK 77 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 9.3 Identities = 12/72 (16%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 58 QEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYERE-EECLTNDLS 116 ++ NR R+ + ++E+++ +K + +E+E + +RE + Sbjct: 6 RDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKE 65 Query: 117 RKLNQLRQEKCR 128 R N+ +E+ + Sbjct: 66 RSRNRTERERSK 77 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.311 0.126 0.336 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,076 Number of Sequences: 429 Number of extensions: 2940 Number of successful extensions: 60 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 20 Number of HSP's gapped (non-prelim): 52 length of query: 356 length of database: 140,377 effective HSP length: 58 effective length of query: 298 effective length of database: 115,495 effective search space: 34417510 effective search space used: 34417510 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -