BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000320-TA|BGIBMGA000320-PA|IPR002893|Zinc finger, MYND-type, IPR009009|Barwin-related endoglucanase, IPR007320|Programmed cell death protein 2, C-terminal (353 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 4.2 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 9.7 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.6 bits (51), Expect = 4.2 Identities = 8/17 (47%), Positives = 9/17 (52%) Query: 133 CGARGPAHCSRCKKVYY 149 C +GP C CK V Y Sbjct: 481 CWGKGPEQCLECKNVKY 497 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 9.7 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 12/75 (16%) Query: 118 DEEFPMDHWTKLCD----VCGARGPA---HCSRCKKVYY---CSRKHQIID-WQKGHKEQ 166 DE +D+ T CD VC + HC C+ Y+ K + GH + Sbjct: 447 DERGSLDN-TPSCDPVTGVCSCKENVEGRHCRECRLGYFNLDAENKFGCTPCFCYGHTLE 505 Query: 167 CPQLQSGDIVSTNNF 181 C IVST+NF Sbjct: 506 CTSASGYSIVSTSNF 520 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.322 0.138 0.450 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 401,854 Number of Sequences: 2123 Number of extensions: 17403 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 28 Number of HSP's gapped (non-prelim): 2 length of query: 353 length of database: 516,269 effective HSP length: 65 effective length of query: 288 effective length of database: 378,274 effective search space: 108942912 effective search space used: 108942912 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -