BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000320-TA|BGIBMGA000320-PA|IPR002893|Zinc finger, MYND-type, IPR009009|Barwin-related endoglucanase, IPR007320|Programmed cell death protein 2, C-terminal (353 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02220.1 68417.m00300 zinc finger (MYND type) family protein ... 217 1e-56 At5g64830.1 68418.m08156 programmed cell death 2 C-terminal doma... 73 2e-13 At4g24560.1 68417.m03520 ubiquitin-specific protease 16, putativ... 54 1e-07 At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase f... 54 2e-07 At5g65450.1 68418.m08231 ubiquitin carboxyl-terminal hydrolase f... 52 6e-07 At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15) ... 51 1e-06 At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase f... 49 4e-06 At5g50450.1 68418.m06247 zinc finger (MYND type) family protein ... 40 0.003 At1g70150.1 68414.m08072 zinc finger (MYND type) family protein ... 37 0.018 At1g67340.1 68414.m07665 zinc finger (MYND type) family protein ... 37 0.018 At3g10200.1 68416.m01221 dehydration-responsive protein-related ... 35 0.094 At3g17670.1 68416.m02256 ferredoxin-related contains Pfam PF0051... 33 0.38 At2g17900.1 68415.m02073 zinc finger (MYND type) family protein ... 32 0.66 At3g04720.1 68416.m00508 hevein-like protein (HEL) identical to ... 29 3.5 At5g06230.2 68418.m00695 expressed protein contains Pfam profile... 29 4.7 At5g06230.1 68418.m00696 expressed protein contains Pfam profile... 29 4.7 At5g16680.1 68418.m01951 PHD finger family protein contains Pfam... 29 6.2 At3g21820.1 68416.m02751 SET domain-containing protein contains ... 29 6.2 At5g55840.1 68418.m06958 pentatricopeptide (PPR) repeat-containi... 28 8.2 At2g44380.1 68415.m05520 DC1 domain-containing protein highly si... 28 8.2 At2g28270.1 68415.m03431 DC1 domain-containing protein contains ... 28 8.2 >At4g02220.1 68417.m00300 zinc finger (MYND type) family protein / programmed cell death 2 C-terminal domain-containing protein similar to SP|Q16342 Programmed cell death protein 2 (Zinc finger protein Rp-8) {Homo sapiens}; contains Pfam profiles PF01753: MYND finger, PF04194: Programmed cell death protein 2, C-terminal putative domain Length = 418 Score = 217 bits (529), Expect = 1e-56 Identities = 124/362 (34%), Positives = 181/362 (50%), Gaps = 25/362 (6%) Query: 6 VDIGVLEE-KPSWLLHPRFFPSKIGGKPSWLNLQDLPKSSELLCKKCQDPTVFLCQVYAP 64 V +G +E K +W + FP+ GG P+WL+ +LP +LC C++P F+ Q+YAP Sbjct: 52 VMLGFVESPKFAWSNLRQLFPNLAGGVPAWLDPVNLPSGKSILCDLCEEPMQFVLQLYAP 111 Query: 65 FEDVEDCFHRTIFIFICKNGNCCSKNHTDNF-----------IVLRCQLPRTNDFYSYQP 113 D E FHRT+F+F+C + +C ++ + + V RCQLPR N FYS + Sbjct: 112 LTDKESAFHRTLFLFMCPSMSCLLRDQHEQWKRAPEKAMRSTKVFRCQLPRANPFYSSEA 171 Query: 114 YEEKDEEFPMDHWTKLCDVCGA-RGPAHCSRCKKVYYCSRKHQIIDWQKGHKEQCPQL-- 170 + + P+ H LC CG +G CS CK YCS KHQ + W+ GHK +C QL Sbjct: 172 PKHDGTDKPLGHGAPLCTWCGTWKGDKLCSGCKNARYCSPKHQALHWRLGHKTECQQLRT 231 Query: 171 --QSGDIVSTNNFKITKAGQSVLFKE-WELIVXXXXXXXPNNTDINQEMEKLNKMMQEKK 227 ++ D NN Q V K W+ V +T+++ + E ++ +++ Sbjct: 232 VSETSDSGPVNNGVAPTEKQKVASKSLWKEFVLINEDESEYDTEMSGDDEVAKPLVSKRE 291 Query: 228 VGXXXXXXXXXXXXYTRTVPNDKVFNKFSKRVARHPEQVLRYDR--GGVPLW-ITSNNDS 284 V + K + F +RV + PEQVLRY R G PLW I S S Sbjct: 292 VDDQMKSLMNDFEGDA----DKKNWVNFQQRVDKAPEQVLRYSRSSGAKPLWPIASGRVS 347 Query: 285 LVHRPKCEYCNGERQFEFQIMPQLLNFLDVGVELNSIDWGVLAIYTCKASCNKGSAYMLE 344 P C+ C G R FEFQ+MPQLL F E S+DW + +YTC+ SC+ +Y E Sbjct: 348 KSELPSCKSCGGPRCFEFQVMPQLLFFFGGKNERESLDWATIVVYTCENSCDSSLSYKEE 407 Query: 345 YM 346 ++ Sbjct: 408 FV 409 >At5g64830.1 68418.m08156 programmed cell death 2 C-terminal domain-containing protein low similarity to SP|P46718 Programmed cell death protein 2 (Zinc finger protein Rp-8) {Mus musculus}; contains Pfam profile PF04194: Programmed cell death protein 2, C-terminal domain Length = 380 Score = 73.3 bits (172), Expect = 2e-13 Identities = 39/101 (38%), Positives = 54/101 (53%), Gaps = 10/101 (9%) Query: 242 YTRTVPNDKVFNKFSKRVARHPEQVLRYDRGGVPLWITSNNDSLVHRPKCEYCNGERQFE 301 Y + + D+ + KF KR+ +PEQ RY GG P+ T + S KC C+ +R FE Sbjct: 251 YDKALNADRTYLKFKKRLDANPEQCFRYWYGGKPILATEDMKS---PDKCRNCDSQRHFE 307 Query: 302 FQIMPQLLNFLDVGV-------ELNSIDWGVLAIYTCKASC 335 Q+MP L+ FL GV L++ DW L +YTC SC Sbjct: 308 IQLMPPLIYFLHEGVVDKGIKQSLDNWDWMTLIVYTCSKSC 348 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Query: 24 FPSKIGGKPSWLNLQDLPKSSELL-CKKCQDPTVFLCQVYAPFE-DVEDCFHRTIFIFIC 81 + +KIGG P W + D ELL C C + QVYAP ++ D RT++IF C Sbjct: 23 YTTKIGGLPDWPPIPDDALKPELLNCCSCGSKLSLVAQVYAPISTEILDIQERTLYIFGC 82 Query: 82 KNGNC 86 C Sbjct: 83 LMPKC 87 >At4g24560.1 68417.m03520 ubiquitin-specific protease 16, putative (UBP16) similar to ubiquitin-specific protease 16 GI:11993477 [Arabidopsis thaliana] Length = 1008 Score = 54.4 bits (125), Expect = 1e-07 Identities = 21/38 (55%), Positives = 25/38 (65%) Query: 130 CDVCGARGPAHCSRCKKVYYCSRKHQIIDWQKGHKEQC 167 C VC CSRCK V YCS K QII W++GHK++C Sbjct: 74 CPVCYCLATTRCSRCKAVRYCSGKCQIIHWRQGHKDEC 111 >At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 672 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/48 (47%), Positives = 26/48 (54%) Query: 127 TKLCDVCGARGPAHCSRCKKVYYCSRKHQIIDWQKGHKEQCPQLQSGD 174 T C VCG CSRCK V YCS Q DW+ GHK +C +S D Sbjct: 61 TAECSVCGKATTKKCSRCKSVRYCSAACQTSDWKSGHKLKCKGFRSTD 108 >At5g65450.1 68418.m08231 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 16 (UBP16) [Arabidopsis thaliana] GI:11993477; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 731 Score = 52.0 bits (119), Expect = 6e-07 Identities = 20/38 (52%), Positives = 25/38 (65%) Query: 130 CDVCGARGPAHCSRCKKVYYCSRKHQIIDWQKGHKEQC 167 C VC CS+CK V YCS K QI+ W++GHKE+C Sbjct: 57 CAVCLYPTTTRCSQCKSVRYCSSKCQILHWRRGHKEEC 94 >At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15) almost identical to ubiquitin-specific protease 15 GI:11993475 [Arabidopsis thaliana], 7 amino acid difference Length = 924 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Query: 129 LCDVCGARGPAHCSRCKKVYYCSRKHQIIDWQKGHKEQCPQLQSGDIVSTNNFKITKAGQ 188 +C C CSRCK V YCS K QII W+ HK++C ++S S+++ +++ Sbjct: 129 VCARCFGPAKTRCSRCKSVRYCSGKCQIIHWRVAHKDECVPVES---CSSSSERVSFEKD 185 Query: 189 SVLF 192 SVL+ Sbjct: 186 SVLY 189 >At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 631 Score = 49.2 bits (112), Expect = 4e-06 Identities = 19/38 (50%), Positives = 21/38 (55%) Query: 130 CDVCGARGPAHCSRCKKVYYCSRKHQIIDWQKGHKEQC 167 C VCG CSRCK V YCS + Q DW GH+ C Sbjct: 61 CSVCGNFSTKKCSRCKSVRYCSAECQRSDWSSGHQRNC 98 >At5g50450.1 68418.m06247 zinc finger (MYND type) family protein contains Pfam profile PF01753: MYND finger Length = 336 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/30 (53%), Positives = 19/30 (63%) Query: 141 CSRCKKVYYCSRKHQIIDWQKGHKEQCPQL 170 CS C KV YCSR Q +DW+ HK +C L Sbjct: 279 CSVCGKVNYCSRGCQALDWRAKHKVECTPL 308 >At1g70150.1 68414.m08072 zinc finger (MYND type) family protein contains Pfam profile PF01753: MYND finger Length = 387 Score = 37.1 bits (82), Expect = 0.018 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 141 CSRCKKVYYCSRKHQIIDWQKGHKEQCPQLQ 171 C +C V YCS HQI W HKE+C +L+ Sbjct: 20 CGQCGAVAYCSVSHQISHWSY-HKEECERLE 49 >At1g67340.1 68414.m07665 zinc finger (MYND type) family protein / F-box family protein Length = 379 Score = 37.1 bits (82), Expect = 0.018 Identities = 15/31 (48%), Positives = 18/31 (58%) Query: 141 CSRCKKVYYCSRKHQIIDWQKGHKEQCPQLQ 171 CS C V YCSR Q +DW+ HK C +Q Sbjct: 320 CSVCGVVNYCSRACQALDWKLRHKMDCAPVQ 350 >At3g10200.1 68416.m01221 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 591 Score = 34.7 bits (76), Expect = 0.094 Identities = 30/81 (37%), Positives = 41/81 (50%), Gaps = 14/81 (17%) Query: 91 HTDNFIVLR--CQLPRTNDFYSYQ--PYEEKDEEFPMDHWTKLCDVCGARGPAHCSRCKK 146 HT++ I+L+ +L R N F+ Y P KD+E+PM W KL ++ A C K Sbjct: 280 HTNDGILLKEVHRLLRPNGFFVYSSPPAYRKDKEYPM-IWDKLVNLTSA-------MCWK 331 Query: 147 VYYCSRKHQIIDWQKGHKEQC 167 + SRK Q W K KE C Sbjct: 332 L--ISRKVQTAIWIKEEKEVC 350 >At3g17670.1 68416.m02256 ferredoxin-related contains Pfam PF00515: TPR Domain; similar to ferredoxin PetF2 (GI:22651984) [Synechococcus sp. PCC 7002] Length = 366 Score = 32.7 bits (71), Expect = 0.38 Identities = 12/26 (46%), Positives = 13/26 (50%) Query: 119 EEFPMDHWTKLCDVCGARGPAHCSRC 144 E P W K C CG G + CSRC Sbjct: 86 EMLPRGEWPKWCKSCGGSGLSDCSRC 111 >At2g17900.1 68415.m02073 zinc finger (MYND type) family protein / SET domain-containing protein contains Pfam profiles PF00856: SET domain, PF01753: MYND zinc finger (ZnF) domain; confirmed by cDNA (Paola Vittorioso--accession not assigned yet (paola.vittorioso@uniroma1.it) Length = 480 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Query: 130 CDVC-GARGPAHCSRCKKVYYCSRKHQIIDWQKGHKEQCPQL 170 CD C CS C+ V+YC Q +W K H+++C L Sbjct: 56 CDGCFKTNNLKKCSACQVVWYCGSSCQKSEW-KLHRDECKAL 96 >At3g04720.1 68416.m00508 hevein-like protein (HEL) identical to SP|P43082 Hevein-like protein precursor {Arabidopsis thaliana}; similar to SP|P09762 Wound-induced protein WIN2 precursor {Solanum tuberosum}; contains Pfam profile PF00187: Chitin recognition protein Length = 212 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 126 WTKLCDVCGARGPAHCSRCKKV 147 WT C G RG A C +C +V Sbjct: 117 WTAFCGPAGPRGQASCGKCLRV 138 >At5g06230.2 68418.m00695 expressed protein contains Pfam profile PF03005: Arabidopsis proteins of unknown function Length = 372 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Query: 157 IDWQ-KGHKEQCPQLQSGDIVS-TNNFKITKAGQSVLFKEWELIVXXXXXXXPNNTDI 212 +DW+ + H P+ + D++ + N +I G S+ +WE ++ PN ++I Sbjct: 68 LDWRWQPHGCDLPRFNASDLLERSRNGRIVFVGDSIGRNQWESLMCMLSQAIPNKSEI 125 >At5g06230.1 68418.m00696 expressed protein contains Pfam profile PF03005: Arabidopsis proteins of unknown function Length = 413 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Query: 157 IDWQ-KGHKEQCPQLQSGDIVS-TNNFKITKAGQSVLFKEWELIVXXXXXXXPNNTDI 212 +DW+ + H P+ + D++ + N +I G S+ +WE ++ PN ++I Sbjct: 109 LDWRWQPHGCDLPRFNASDLLERSRNGRIVFVGDSIGRNQWESLMCMLSQAIPNKSEI 166 >At5g16680.1 68418.m01951 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 1290 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 7/45 (15%) Query: 116 EKDEEFPMDHWTKLCDVCGARGP----AHCSRCK---KVYYCSRK 153 E D+ ++H K+CD+CG G A CS C + YC R+ Sbjct: 272 ESDDSEMVEHDVKVCDICGDAGREDLLAICSGCSDGAEHTYCMRE 316 >At3g21820.1 68416.m02751 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 473 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/39 (30%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Query: 138 PAHC-SRCKKVYYCSRKHQIIDWQKGHKEQCPQLQSGDI 175 P C C++ +YCS DW+ H C +S I Sbjct: 173 PLSCPGGCQEAFYCSESCAAADWESSHSLLCTGERSESI 211 >At5g55840.1 68418.m06958 pentatricopeptide (PPR) repeat-containing protein low similarity to fertility restorer [Petunia x hybrida] GI:22128587; contains Pfam profile PF01535: PPR repeat Length = 1274 Score = 28.3 bits (60), Expect = 8.2 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 8/88 (9%) Query: 26 SKIGGKPSWLNLQDLPKSSELLCK--KCQDPTVFLCQVYAPFEDVEDCFHRTIFIFICKN 83 +K+G P++ L K LCK ++ FL ++A V+ + T+ +CK+ Sbjct: 570 TKVGHHPTFFTYGSLLKG---LCKGGHLREAEKFLKSLHAVPAAVDTVMYNTLLTAMCKS 626 Query: 84 GNCCSKNHTDNFIVLRCQLPRTNDFYSY 111 GN +V R LP D Y+Y Sbjct: 627 GNLAKAVSLFGEMVQRSILP---DSYTY 651 >At2g44380.1 68415.m05520 DC1 domain-containing protein highly similar to GP|2435515|AF024504; contains Pfam profile PF03107: DC1 domain Length = 247 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/64 (26%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Query: 87 CSKNHTDNFIVLRC-QLPRTNDFYSYQPYEEKDEEFPMDHWTKLCDVCGARGPAHCSRCK 145 C K+ D F+ C LPR + S+ + P + CD CG G C Sbjct: 48 CMKSDCDYFLHKSCFDLPRETNHKSHPNHSLTLLHSPPYGQSYTCDACGEYGSGFTYNCS 107 Query: 146 KVYY 149 + Y Sbjct: 108 ECQY 111 >At2g28270.1 68415.m03431 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 248 Score = 28.3 bits (60), Expect = 8.2 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 5/64 (7%) Query: 87 CSKNHTDNFIVLRC-QLPRTNDFYSYQPYEEKDEEFPMDHW-TKLCDVCGARGPA---HC 141 C+K+ D F+ C LP S+ + P + T CD CG G A HC Sbjct: 47 CTKSECDYFLHKSCFDLPGEIHHKSHTNHPLTLLHSPPNGLSTYTCDACGEYGSAFTYHC 106 Query: 142 SRCK 145 S CK Sbjct: 107 SECK 110 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.322 0.138 0.450 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,206,105 Number of Sequences: 28952 Number of extensions: 407540 Number of successful extensions: 723 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 700 Number of HSP's gapped (non-prelim): 24 length of query: 353 length of database: 12,070,560 effective HSP length: 82 effective length of query: 271 effective length of database: 9,696,496 effective search space: 2627750416 effective search space used: 2627750416 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -