BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000318-TA|BGIBMGA000318-PA|undefined (85 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0832 - 6500139-6500333,6500610-6500875,6501494-6501815,650... 27 1.9 01_04_0116 + 16189250-16189411,16189577-16190104 26 3.3 09_02_0166 + 5213693-5213979,5214190-5214506,5214594-5214730 25 5.7 06_03_0107 + 16709543-16709640,16712555-16713408,16715051-167151... 25 10.0 04_04_1655 - 35089916-35091157 25 10.0 04_04_1581 - 34581455-34581466,34581525-34581616,34582584-345826... 25 10.0 >01_01_0832 - 6500139-6500333,6500610-6500875,6501494-6501815, 6501915-6502156,6502229-6502457,6503020-6503184, 6503279-6503605,6504150-6504191,6504333-6504400, 6504748-6504934,6506249-6506311,6506748-6506790, 6506919-6507019,6507110-6507184,6507359-6507445, 6507593-6507682,6507906-6507992,6508585-6508783, 6509113-6509177,6509502-6509606,6509726-6509871, 6510100-6510224,6510335-6510437,6510482-6510596, 6510734-6510869,6511298-6511387,6511484-6511578, 6511698-6511763,6511868-6511936,6512034-6512147, 6512241-6512448,6512545-6512600,6512818-6513552 Length = 1671 Score = 27.1 bits (57), Expect = 1.9 Identities = 12/30 (40%), Positives = 15/30 (50%) Query: 28 STEEQRCGARAQVTPQRTLCTDSRAGRTSP 57 S +Q C + AQV + T C DS R P Sbjct: 322 SNNDQECQSEAQVVGKSTGCCDSCGNRVPP 351 >01_04_0116 + 16189250-16189411,16189577-16190104 Length = 229 Score = 26.2 bits (55), Expect = 3.3 Identities = 13/32 (40%), Positives = 15/32 (46%) Query: 21 RSSSFTRSTEEQRCGARAQVTPQRTLCTDSRA 52 RSS RST +RC + P T C S A Sbjct: 90 RSSLEERSTSSRRCSGTTSLCPTHTPCIASLA 121 >09_02_0166 + 5213693-5213979,5214190-5214506,5214594-5214730 Length = 246 Score = 25.4 bits (53), Expect = 5.7 Identities = 11/29 (37%), Positives = 16/29 (55%) Query: 35 GARAQVTPQRTLCTDSRAGRTSPTMNRAI 63 GA+ P DS+ +T+P +NRAI Sbjct: 60 GAKPAQEPSADAAQDSKRTQTAPRLNRAI 88 >06_03_0107 + 16709543-16709640,16712555-16713408,16715051-16715193, 16715312-16715573,16715835-16716150,16716257-16716383, 16717088-16717149,16717291-16717374,16717438-16717494, 16717705-16717768,16718057-16718152 Length = 720 Score = 24.6 bits (51), Expect = 10.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Query: 28 STEEQRCGARAQVTPQRTLCTDSRAGRTSPTMNRAI 63 ST GA ++ TP+ +L + +TS T RAI Sbjct: 621 STTIHNTGASSKSTPEISLADKTPTEKTSSTTKRAI 656 >04_04_1655 - 35089916-35091157 Length = 413 Score = 24.6 bits (51), Expect = 10.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Query: 30 EEQRCGARAQVTPQRTLCTDSRAGRTSPTM 59 + ++CG R + + TL +RA R SP + Sbjct: 373 QSEQCGERTRERARETLRLHARAWRNSPCL 402 >04_04_1581 - 34581455-34581466,34581525-34581616,34582584-34582686, 34583761-34583837,34583913-34583959,34584494-34584594, 34584751-34584840,34585152-34585271,34586171-34586517, 34587013-34587285,34587835-34588165 Length = 530 Score = 24.6 bits (51), Expect = 10.0 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 6 GGLVRCGGPVVVSLARSSSFTRSTEEQRCGARAQVTPQRTLCTDSRAGRTSPTMNRAIFY 65 GGL+ P VS + R + CG + P C +RA T+ R + Sbjct: 229 GGLLTNTAPATVSQIHARCRRRQIY-RCCGLLPRAPPPSDPCAFARATITAARSARGLLS 287 Query: 66 QLSGGV 71 L GG+ Sbjct: 288 HLYGGL 293 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.129 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,503,724 Number of Sequences: 37544 Number of extensions: 82854 Number of successful extensions: 174 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 169 Number of HSP's gapped (non-prelim): 6 length of query: 85 length of database: 14,793,348 effective HSP length: 64 effective length of query: 21 effective length of database: 12,390,532 effective search space: 260201172 effective search space used: 260201172 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -