GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000318-TA|BGIBMGA000318-PA|undefined
         (85 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK057223-1|BAB71386.1|  379|Homo sapiens protein ( Homo sapiens ...    29   3.1  

>AK057223-1|BAB71386.1|  379|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32661 fis, clone TESTI1000055, weakly similar to
           HOMEOBOX PROTEIN SIX1. ).
          Length = 379

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 17/57 (29%), Positives = 24/57 (42%)

Query: 29  TEEQRCGARAQVTPQRTLCTDSRAGRTSPTMNRAIFYQLSGGVGAPRSVAERSNMTL 85
           T  Q+   R +  P  +LC +    R  P   R   +  + GV    S AER N+ L
Sbjct: 116 TPVQKFRCRKRNPPPPSLCPEGLKSRNFPREVREKLHNFAVGVNTNPSKAERENLAL 172


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.318    0.129    0.372 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,574,501
Number of Sequences: 224733
Number of extensions: 361859
Number of successful extensions: 959
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 958
Number of HSP's gapped (non-prelim): 1
length of query: 85
length of database: 73,234,838
effective HSP length: 63
effective length of query: 22
effective length of database: 59,076,659
effective search space: 1299686498
effective search space used: 1299686498
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 57 (27.1 bits)