BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000317-TA|BGIBMGA000317-PA|undefined (161 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.10 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 3.8 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 6.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 6.7 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 20 8.8 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.6 bits (56), Expect = 0.10 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Query: 126 PGDNFSYDSFQ--EWDGPLEPHWSSQPTSREIKCEENY 161 PG +Y +Q EW P+ P P E+K + Y Sbjct: 1360 PGSTTNYPEWQPTEWHPPIPPTSEKPPLPEELKPQSGY 1397 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 3.8 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 44 SSFNGESG--ARHGNSTEYTVSESRAEMVRSERERLHTETRRSPPEEKRPPLVPLP 97 SS NG + +G S+ S + S+R+R T+ S P PPL P P Sbjct: 68 SSLNGLTNNVPSNGLSSSGPFSSIGGGISASKRQR--TDDWLSSPSGNVPPLTPSP 121 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 20.6 bits (41), Expect = 6.7 Identities = 7/14 (50%), Positives = 9/14 (64%) Query: 90 RPPLVPLPAFQQAF 103 RPP+ P PA Q + Sbjct: 161 RPPMYPFPAGQYPY 174 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 20.6 bits (41), Expect = 6.7 Identities = 7/14 (50%), Positives = 9/14 (64%) Query: 90 RPPLVPLPAFQQAF 103 RPP+ P PA Q + Sbjct: 53 RPPMYPFPAGQYPY 66 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 20.2 bits (40), Expect = 8.8 Identities = 8/26 (30%), Positives = 13/26 (50%) Query: 51 GARHGNSTEYTVSESRAEMVRSERER 76 GA HG+ Y + + R+ R+R Sbjct: 441 GAAHGDDVPYIFNMGLFDTSRNHRDR 466 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.311 0.129 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,013 Number of Sequences: 317 Number of extensions: 1801 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 161 length of database: 114,650 effective HSP length: 52 effective length of query: 109 effective length of database: 98,166 effective search space: 10700094 effective search space used: 10700094 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (20.9 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -