BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000317-TA|BGIBMGA000317-PA|undefined (161 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 24 0.85 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 0.85 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 0.85 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 0.85 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 0.85 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 0.85 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 24 0.85 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 0.85 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 24 0.85 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 0.85 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 0.85 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 1.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 2.0 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 2.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 2.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 2.6 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 2.6 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 6.0 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 6.0 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 6.0 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 6.0 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 6.0 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 7.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 7.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 7.9 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + R E + +E+E+L E Sbjct: 207 RSRTHGFQHTSSRYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEE 254 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + R E + +E+E+L E Sbjct: 218 RSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEE 265 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + R E + +E+E+L E Sbjct: 218 RSRTHGFQHTSSHYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEE 265 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + R E + +E+E+L E Sbjct: 218 RSRTHGFQHTSSHYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEE 265 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + R E + +E+E+L E Sbjct: 218 RSRTHGFQHTSSHYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEE 265 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + R E + +E+E+L E Sbjct: 218 RSRTHGFQHTSSHYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEE 265 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + R E + +E+E+L E Sbjct: 207 RSRTHGFQHTSSHYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEE 254 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + R E + +E+E+L E Sbjct: 218 RSRTHGFQHTSSHYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEE 265 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + R E + +E+E+L E Sbjct: 218 RSRTHGFQHTSSRYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEE 265 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + R E + +E+E+L E Sbjct: 218 RSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEE 265 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + R E + +E+E+L E Sbjct: 218 RSRTHDFQHTSSRYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEE 265 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.0 bits (47), Expect = 1.5 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query: 42 GDSSFNGESGARHGNSTEYTVSESRAE--MVR-SERERLHTETRRSPP 86 G +S +SG+ +G+ T TVS+ + + MV+ + +H E PP Sbjct: 1065 GITSSGSDSGSSNGSWTAGTVSQQKQKRRMVKYGKLVMIHEENAPLPP 1112 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.6 bits (46), Expect = 2.0 Identities = 12/48 (25%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 R+ T + S ++ E + EY + R E + +E+E+L E Sbjct: 218 RNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEE 265 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.6 bits (46), Expect = 2.0 Identities = 12/48 (25%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 R+ T + S ++ E + EY + R E + +E+E+L E Sbjct: 223 RNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEE 270 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.6 bits (46), Expect = 2.0 Identities = 12/48 (25%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 R+ T + S ++ E + EY + R E + +E+E+L E Sbjct: 218 RNRTHGFQHTSSRYSRERSCSRDRNREYREKDRRYEKLHNEKEKLLEE 265 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 2.6 Identities = 12/48 (25%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + + E + +E+E+L E Sbjct: 207 RSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEE 254 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.6 Identities = 12/48 (25%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + + E + +E+E+L E Sbjct: 218 RSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEE 265 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/48 (22%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 R+ T + S ++ E + EY + + E + +E+E+L E Sbjct: 207 RNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEE 254 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/48 (22%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 R+ T + S ++ E + EY + + E + +E+E+L E Sbjct: 218 RNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEE 265 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/48 (22%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 R+ T + S ++ E + EY + + E + +E+E+L E Sbjct: 218 RNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEE 265 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/48 (22%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 R+ T + S ++ E + EY + + E + +E+E+L E Sbjct: 207 RNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEE 254 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/48 (22%), Positives = 22/48 (45%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 R+ T + S ++ E + EY + + E + +E+E+L E Sbjct: 207 RNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEE 254 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.6 bits (41), Expect = 7.9 Identities = 11/48 (22%), Positives = 21/48 (43%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + + E + +E+E+ E Sbjct: 218 RSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEE 265 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.6 bits (41), Expect = 7.9 Identities = 11/48 (22%), Positives = 21/48 (43%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + + E + +E+E+ E Sbjct: 218 RSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEE 265 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.6 bits (41), Expect = 7.9 Identities = 11/48 (22%), Positives = 21/48 (43%) Query: 33 RSATPYPMYGDSSFNGESGARHGNSTEYTVSESRAEMVRSERERLHTE 80 RS T + S ++ E + EY + + E + +E+E+ E Sbjct: 218 RSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEE 265 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.311 0.129 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,670 Number of Sequences: 429 Number of extensions: 2724 Number of successful extensions: 25 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of query: 161 length of database: 140,377 effective HSP length: 53 effective length of query: 108 effective length of database: 117,640 effective search space: 12705120 effective search space used: 12705120 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.4 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -