BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000315-TA|BGIBMGA000315-PA|undefined (130 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 27 0.075 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 27 0.075 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 23 1.2 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 26.6 bits (56), Expect = 0.075 Identities = 9/36 (25%), Positives = 23/36 (63%) Query: 89 NHSHQITVLVITMTILFSACILAAICFVEMRMRKET 124 N HQ++++V ++ ++FSA + + ++ R++T Sbjct: 49 NEGHQLSIIVYSILMVFSAIANTTVLVLIVKRRRKT 84 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 26.6 bits (56), Expect = 0.075 Identities = 9/36 (25%), Positives = 23/36 (63%) Query: 89 NHSHQITVLVITMTILFSACILAAICFVEMRMRKET 124 N HQ++++V ++ ++FSA + + ++ R++T Sbjct: 49 NEGHQLSIIVYSILMVFSAIANTTVLVLIVKRRRKT 84 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 22.6 bits (46), Expect = 1.2 Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Query: 27 LPEAVVAIPEEPHDHNESIWSGVKTECSRDQDAT 60 LPE + P+ P +H E+ S ++C D T Sbjct: 29 LPETALEAPKSPENHPETELS--DSDCDLDVTGT 60 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.129 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,933 Number of Sequences: 317 Number of extensions: 1202 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 130 length of database: 114,650 effective HSP length: 50 effective length of query: 80 effective length of database: 98,800 effective search space: 7904000 effective search space used: 7904000 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -