BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000315-TA|BGIBMGA000315-PA|undefined (130 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 22 5.9 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 7.8 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/36 (30%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Query: 76 KQCPNKENKSCC--CNHSHQITVLVITMTILFSACI 109 ++CP E SCC C I+ V T C+ Sbjct: 24 RRCPKNEVYSCCAPCPQKACISEAVKCQTSCLPGCV 59 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 21.8 bits (44), Expect = 7.8 Identities = 12/40 (30%), Positives = 18/40 (45%) Query: 6 SNTEELGPYHSKFGGYERKYALPEAVVAIPEEPHDHNESI 45 S+ +E G Y S Y R + E A+P P + S+ Sbjct: 394 SHWQEEGVYWSLHYLYNRLRDISEETSALPSHPRRRSNSL 433 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.129 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,752 Number of Sequences: 2123 Number of extensions: 4791 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 130 length of database: 516,269 effective HSP length: 57 effective length of query: 73 effective length of database: 395,258 effective search space: 28853834 effective search space used: 28853834 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -