GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000315-TA|BGIBMGA000315-PA|undefined
         (130 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    21   5.8  
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    20   7.7  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    20   7.7  

>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%)

Query: 21  YERKYALPEAVVAIPEEPHDHNESIWSGVKTECSRDQD 58
           Y  +Y LP   V IP++P    E      KT+C   QD
Sbjct: 415 YIEEY-LPGNGVIIPDDPPIGCECKTCNSKTKCCFAQD 451


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 20.2 bits (40), Expect = 7.7
 Identities = 6/12 (50%), Positives = 9/12 (75%)

Query: 77  QCPNKENKSCCC 88
           +CP + +KSC C
Sbjct: 479 RCPPEIHKSCIC 490


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 20.2 bits (40), Expect = 7.7
 Identities = 6/12 (50%), Positives = 9/12 (75%)

Query: 77  QCPNKENKSCCC 88
           +CP + +KSC C
Sbjct: 479 RCPPEIHKSCIC 490


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.129    0.397 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 40,648
Number of Sequences: 429
Number of extensions: 1664
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of query: 130
length of database: 140,377
effective HSP length: 51
effective length of query: 79
effective length of database: 118,498
effective search space:  9361342
effective search space used:  9361342
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.3 bits)
S2: 40 (20.2 bits)