BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000312-TA|BGIBMGA000312-PA|IPR002483|Splicing factor PWI (869 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 pro... 25 2.9 AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 prot... 25 2.9 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 8.9 >AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 protein. Length = 384 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 326 DGRVHALDDVQETGLETVA 344 DG V LDD + TGLE +A Sbjct: 64 DGSVSVLDDWEMTGLEELA 82 >AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 protein. Length = 384 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 326 DGRVHALDDVQETGLETVA 344 DG V LDD + TGLE +A Sbjct: 64 DGSVSVLDDWEMTGLEELA 82 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.0 bits (47), Expect = 8.9 Identities = 12/37 (32%), Positives = 17/37 (45%) Query: 464 NDGKTQSDHTDDEEKEDIVNIPNLREYSKSLSRTPSP 500 N K SD D E+ +I N S+++TP P Sbjct: 400 NGKKGSSDSCSDSEENSQSDITNNVNSPASMNQTPPP 436 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.305 0.124 0.335 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,184 Number of Sequences: 317 Number of extensions: 3511 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 3 length of query: 869 length of database: 114,650 effective HSP length: 63 effective length of query: 806 effective length of database: 94,679 effective search space: 76311274 effective search space used: 76311274 T: 11 A: 40 X1: 16 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -