BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000310-TA|BGIBMGA000310-PA|IPR000195|RabGAP/TBC (480 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 4.7 AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 23 4.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/24 (41%), Positives = 11/24 (45%) Query: 281 DRILSARSADEFYSCMGGGAGAVW 304 D I R EF MG G G +W Sbjct: 2140 DDIGMIRHKSEFIKAMGLGGGMIW 2163 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 23.0 bits (47), Expect = 4.7 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Query: 167 SDSLKVMIYLVEAVLPEGYFADDLRGLSADM 197 SDSL IY +++ P+ F DD G S D+ Sbjct: 192 SDSLSPGIYSEQSLSPDTVFGDD--GKSEDV 220 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.136 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,831 Number of Sequences: 317 Number of extensions: 3138 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 480 length of database: 114,650 effective HSP length: 59 effective length of query: 421 effective length of database: 95,947 effective search space: 40393687 effective search space used: 40393687 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -