BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000309-TA|BGIBMGA000309-PA|IPR001359|Synapsin (310 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.9 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 22 5.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/33 (30%), Positives = 14/33 (42%) Query: 52 IDAKYDIHIQKIGTNYKAFMRKSISGNWKTNQG 84 IDA YD+ + ++ A M G W G Sbjct: 1569 IDAGYDVPVLAQNLDWVAVMTYDFHGQWDKQTG 1601 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 296 MKNLRKTFAGIFGD 309 + NL+ TF G FGD Sbjct: 526 ISNLQTTFGGTFGD 539 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.135 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,981 Number of Sequences: 317 Number of extensions: 1463 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 310 length of database: 114,650 effective HSP length: 57 effective length of query: 253 effective length of database: 96,581 effective search space: 24434993 effective search space used: 24434993 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -