BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000309-TA|BGIBMGA000309-PA|IPR001359|Synapsin (310 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP1E11.11 |||Puf family RNA-binding protein|Schizosaccharomyce... 29 0.84 SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosa... 27 3.4 SPAC17G6.08 |pep7|vac1|prevacuole/endosomal FYVE tethering compo... 26 5.9 SPAC26H5.08c |bgl2||glucan 1,3-beta-glucosidase Bgl2|Schizosacch... 26 7.9 >SPCP1E11.11 |||Puf family RNA-binding protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 642 Score = 29.1 bits (62), Expect = 0.84 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 4/91 (4%) Query: 18 HSGVAKVKVDSLADFQDIAGVVAMLGTYCTVEPYI--DAKYDIHIQKIGTNYKAFMRKSI 75 H A V D+ +F ++ A++ + E + D DIHI K+ ++ R SI Sbjct: 244 HREAAYVVEDAFREFTNLQQQRALICEFYGPEFQVFKDRTQDIHIDKLLIDHPE-KRPSI 302 Query: 76 SGN-WKTNQGSAMLEAIGMNDRYKMWIDEVS 105 N WKT +GS +IG ++ ++ ++ Sbjct: 303 MQNLWKTIEGSIAKGSIGFTMVHRAMLEFIN 333 >SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 466 Score = 27.1 bits (57), Expect = 3.4 Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 70 FMRKSISGNWKTNQGSAMLEAIGMNDRYKMWIDE 103 +++K+ SG+W N + + I M + K W DE Sbjct: 176 YVKKASSGSWGANDIITLEKEIAMFKKKKNWSDE 209 >SPAC17G6.08 |pep7|vac1|prevacuole/endosomal FYVE tethering component Pep7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 536 Score = 26.2 bits (55), Expect = 5.9 Identities = 12/39 (30%), Positives = 22/39 (56%) Query: 93 MNDRYKMWIDEVSEIFGGLEVCALELVVGKDGREHIIEL 131 M + Y+++ D +SE+ G + L + KD R+ +EL Sbjct: 361 MVNYYRLYEDSLSELLSGEIITEATLKIVKDRRKKFLEL 399 >SPAC26H5.08c |bgl2||glucan 1,3-beta-glucosidase Bgl2|Schizosaccharomyces pombe|chr 1|||Manual Length = 321 Score = 25.8 bits (54), Expect = 7.9 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 14 IGHAHSGVAKVKVDSLADFQDIAGVVAMLGTYCT 47 + HA G K D LADF+ +A M+ TY T Sbjct: 48 VKHA-DGTCKYTDDYLADFEVLAPYTNMIRTYAT 80 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.319 0.135 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 889,258 Number of Sequences: 5004 Number of extensions: 29748 Number of successful extensions: 78 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 75 Number of HSP's gapped (non-prelim): 4 length of query: 310 length of database: 2,362,478 effective HSP length: 73 effective length of query: 237 effective length of database: 1,997,186 effective search space: 473333082 effective search space used: 473333082 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -