BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000308-TA|BGIBMGA000308-PA|IPR001359|Synapsin (338 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein ... 25 3.0 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 5.3 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 7.0 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 9.2 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 9.2 >CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein protein. Length = 207 Score = 25.0 bits (52), Expect = 3.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 187 VDDQNTDWSKYFRGRRLPGEWD 208 V ++ DW+ RRLP +WD Sbjct: 170 VASEHPDWAFVAANRRLPFDWD 191 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.2 bits (50), Expect = 5.3 Identities = 12/24 (50%), Positives = 14/24 (58%) Query: 48 ARSSVEALRRFSSGDLQSECDEGE 71 +R E RR S GD SE +EGE Sbjct: 954 SRKRKEKARRGSGGDSDSEEEEGE 977 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 7.0 Identities = 12/49 (24%), Positives = 21/49 (42%) Query: 250 TKRVDTRQWPDFVLVRQNVRDAGADHRALLLGLKFGGVPSINSLNSIYH 298 TK++D + P G D + + L++ P I SL++ H Sbjct: 685 TKKIDIKAAPRIEAKNDAYIPKGGDKKIISTKLQWNAKPKIGSLDNASH 733 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.4 bits (48), Expect = 9.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Query: 54 ALRRFSSGDLQSECDEGEVDPYTGRA 79 ALRR + D Q +EGEV P R+ Sbjct: 85 ALRRAQTQDEQRALNEGEVPPEPPRS 110 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.4 bits (48), Expect = 9.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Query: 54 ALRRFSSGDLQSECDEGEVDPYTGRA 79 ALRR + D Q +EGEV P R+ Sbjct: 85 ALRRAQTQDEQRALNEGEVPPEPPRS 110 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.134 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 287,189 Number of Sequences: 2123 Number of extensions: 9775 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 6 length of query: 338 length of database: 516,269 effective HSP length: 64 effective length of query: 274 effective length of database: 380,397 effective search space: 104228778 effective search space used: 104228778 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -