BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000307-TA|BGIBMGA000307-PA|IPR000834|Peptidase M14, carboxypeptidase A, IPR008969|Carboxypeptidase regulatory region (483 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 26 0.51 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 6.3 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 26.2 bits (55), Expect = 0.51 Identities = 15/52 (28%), Positives = 22/52 (42%) Query: 11 LLLTVSAEFQWKHHNNEELPLVLQEVHNNCPNITRIYALSEPSVCNVPLYVI 62 LLLT+ W + L ++ NCP + ALS + V L+ I Sbjct: 236 LLLTILTYLIWTIYEMYHLAILWSCTSTNCPRFLIMLALSYTVIQEVMLFTI 287 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 6.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 227 ESKTGASAAEYSASPDDETFKELAMTYA 254 E +TG +A YS S D + K+L + +A Sbjct: 286 ERETGHNAPLYSPSSDSQYQKQLNVEHA 313 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.134 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,227 Number of Sequences: 317 Number of extensions: 5605 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 3 length of query: 483 length of database: 114,650 effective HSP length: 59 effective length of query: 424 effective length of database: 95,947 effective search space: 40681528 effective search space used: 40681528 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -