BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000306-TA|BGIBMGA000306-PA|undefined (325 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 5.3 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 9.3 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Query: 269 YFDHCVAMLHKNSPYTEKLSE 289 Y++ C +L+K+S +T+K E Sbjct: 309 YYEICPEILNKDSGWTKKWDE 329 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.4 bits (43), Expect = 9.3 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Query: 233 RKMAFSLEELPAGTFAIGEYLSKEAVQDMQLMLEFFYFDHCVAMLHKNSPYTEKL 287 RK+A L + +I + LS ++ FY+ VA+LH+ P T+ L Sbjct: 88 RKVAGKLIRIFLAAESIDDLLSNAVFCRDRVNPYLFYYAFSVALLHR--PDTQNL 140 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.136 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,298 Number of Sequences: 317 Number of extensions: 3028 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 2 length of query: 325 length of database: 114,650 effective HSP length: 57 effective length of query: 268 effective length of database: 96,581 effective search space: 25883708 effective search space used: 25883708 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -