BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000304-TA|BGIBMGA000304-PA|undefined (180 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogene... 31 0.34 At3g14740.2 68416.m01864 PHD finger family protein similar to zi... 31 0.59 At3g14740.1 68416.m01863 PHD finger family protein similar to zi... 31 0.59 At5g37200.1 68418.m04466 zinc finger (C3HC4-type RING finger) fa... 30 0.78 At5g58610.1 68418.m07345 PHD finger transcription factor, putative 30 1.0 At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to... 30 1.0 At3g61740.1 68416.m06923 PHD finger family protein (ATX3) contai... 29 1.8 At3g46800.1 68416.m05080 DC1 domain-containing protein contains ... 29 1.8 At4g38190.1 68417.m05391 cellulose synthase family protein simil... 29 2.4 At5g53430.1 68418.m06640 PHD finger family protein / SET domain-... 28 4.2 At4g27910.1 68417.m04006 PHD finger protein-related / SET domain... 28 4.2 At4g08590.1 68417.m01412 zinc finger (C3HC4-type RING finger) fa... 28 4.2 At5g36740.1 68418.m04402 PHD finger family protein 27 5.5 At5g36670.1 68418.m04388 PHD finger family protein 27 5.5 At4g14760.1 68417.m02271 M protein repeat-containing protein con... 27 5.5 At1g05055.1 68414.m00506 basic transcription factor 2, 44kD subu... 27 5.5 At1g05380.1 68414.m00546 PHD finger transcription factor, putative 27 7.3 At2g18190.1 68415.m02116 AAA-type ATPase family protein contains... 27 9.6 >At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogenesis repressor; identical to COP1 regulatory protein/FUSCA protein FUS1 GI:402685 SP:P43254 Length = 675 Score = 31.5 bits (68), Expect = 0.34 Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 46 ENDDGSVMDGELAFDLLEEDLTCAVCRQIAVQA 78 ENDDG E+ L++DL C +C QI A Sbjct: 30 ENDDGGSGGSEIGAPDLDKDLLCPICMQIIKDA 62 >At3g14740.2 68416.m01864 PHD finger family protein similar to zinc-finger protein BR140 [PIR|JC2069][Homo sapiens]; contains PHD-finger domain PF00628 Length = 343 Score = 30.7 bits (66), Expect = 0.59 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 63 EEDLTCAVCRQIAVQAGNRLVECDGCRALYH 93 E+ + CAVC+ N +V CDGC + H Sbjct: 148 EDGIMCAVCQSTDGDPLNPIVFCDGCDLMVH 178 >At3g14740.1 68416.m01863 PHD finger family protein similar to zinc-finger protein BR140 [PIR|JC2069][Homo sapiens]; contains PHD-finger domain PF00628 Length = 341 Score = 30.7 bits (66), Expect = 0.59 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 63 EEDLTCAVCRQIAVQAGNRLVECDGCRALYH 93 E+ + CAVC+ N +V CDGC + H Sbjct: 148 EDGIMCAVCQSTDGDPLNPIVFCDGCDLMVH 178 >At5g37200.1 68418.m04466 zinc finger (C3HC4-type RING finger) family protein low similarity to ring-H2 finger protein RHY1a from Arabidopsis thaliana [gi:3790593], ring finger-H2 protein from Xenopus laevis [gi:13752371]; contains Pfam domain zinc finger, C3HC4 type (RING finger) PF00097 Length = 217 Score = 30.3 bits (65), Expect = 0.78 Identities = 12/35 (34%), Positives = 20/35 (57%) Query: 60 DLLEEDLTCAVCRQIAVQAGNRLVECDGCRALYHQ 94 DL EED TC++C + ++ ++ C L+HQ Sbjct: 151 DLEEEDETCSICIEKFSESHEDIIRVPDCLHLFHQ 185 >At5g58610.1 68418.m07345 PHD finger transcription factor, putative Length = 1065 Score = 29.9 bits (64), Expect = 1.0 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 5/31 (16%) Query: 63 EEDLTCAVCRQIAVQAGNRLVECDGCRALYH 93 E D+ C+VC G +L+ CDGC + +H Sbjct: 692 ENDVFCSVCHY-----GGKLILCDGCPSAFH 717 >At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to homeotic protein HAT 3.1 (GI:11994474) [Arabidopsis thaliana] Length = 723 Score = 29.9 bits (64), Expect = 1.0 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 6/55 (10%) Query: 54 DGELAFDLLEEDLTCAVCRQIAVQAGNRLVECDG-CRALYHQVGNVQPVLQHMDL 107 DGE++ ED+ CA C + N ++ CDG C +HQ ++P L+ D+ Sbjct: 258 DGEIS----SEDIFCAKCGSKDLSVDNDIILCDGFCDRGFHQY-CLEPPLRKEDI 307 >At3g61740.1 68416.m06923 PHD finger family protein (ATX3) contains Pfam domains PF00628: PHD-finger and PF00855: PWWP domain; identical to cDNA trithorax 3 (ATX3) partial cds GI:15217142 Length = 799 Score = 29.1 bits (62), Expect = 1.8 Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 68 CAVCRQIAVQAGNRLVECDGCRALYHQ 94 CAVCR + N+++ C+ C+ HQ Sbjct: 493 CAVCRWVEDWEENKMIICNRCQVAVHQ 519 >At3g46800.1 68416.m05080 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 682 Score = 29.1 bits (62), Expect = 1.8 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Query: 61 LLEEDLTCAVCRQIAVQAGNRLVECDGCRALYHQ--VGNVQPVLQHMDLQLIIQVKLHRA 118 LL+E C +C +L EC C L+H VG + V Q + ++ + A Sbjct: 145 LLKEGRNCNMCNTNIKINEKQLCECRLCNILFHLDCVGLIPNVYQTSHPKHPLKFLQYGA 204 Query: 119 PSH-HQECLV 127 P + H++CL+ Sbjct: 205 PEYAHEKCLL 214 >At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays Length = 1111 Score = 28.7 bits (61), Expect = 2.4 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 49 DGSVMDGELAFDLLEEDLTCAVCRQIAVQAGNRLVECDGCRALYHQVGNV 98 DG+VM E D++ + +CR + A C GC+ Y ++G++ Sbjct: 121 DGNVMKDERGKDVMPCECRFKICRDCFMDAQKETGLCPGCKEQY-KIGDL 169 >At5g53430.1 68418.m06640 PHD finger family protein / SET domain-containing protein (TX5) contains Pfam domain, PF00628: PHD-finger and PF00856: SET domain; identical to cDNA trithorax 5 (TX5) partial cds GI:16118406 Length = 1043 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 68 CAVCRQIAVQAGNRLVECDGCRALYHQ 94 CAVCR + N+++ C+ C+ HQ Sbjct: 610 CAVCRWVEDWDYNKIIICNRCQIAVHQ 636 >At4g27910.1 68417.m04006 PHD finger protein-related / SET domain-containing protein (TX4) nearly identical over 285 amino acids to trithorax 4 [Arabidopsis thaliana] GI:16118405; contains Pfam profiles PF00856: SET domain, PF00855: PWWP domain; identical to cDNA trithorax 4 (TX4) partial cds GI:16118404 Length = 1027 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 68 CAVCRQIAVQAGNRLVECDGCRALYHQ 94 CAVCR + N+++ C+ C+ HQ Sbjct: 595 CAVCRWVEDWDYNKIIICNRCQIAVHQ 621 Score = 27.5 bits (58), Expect = 5.5 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Query: 68 CAVCRQIAVQAGNRL-VECDGCRALYH 93 C +C++I N+ V CDGC+ H Sbjct: 401 CGICKKIRNHLDNKSWVRCDGCKVRIH 427 >At4g08590.1 68417.m01412 zinc finger (C3HC4-type RING finger) family protein contains Pfam profiles PF00097: Zinc finger C3HC4 type (RING finger), PF02182: YDG/SRA domain Length = 465 Score = 27.9 bits (59), Expect = 4.2 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Query: 44 ERENDDG---SVMDGELAFDLLEEDLTCAVCRQI 74 E DG S+ DG AF + EDL C++C Q+ Sbjct: 82 ENNKSDGEIASLNDGVDAFTAICEDLNCSLCNQL 115 >At5g36740.1 68418.m04402 PHD finger family protein Length = 1179 Score = 27.5 bits (58), Expect = 5.5 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 5/30 (16%) Query: 65 DLTCAVCRQIAVQAGNRLVECDGCRALYHQ 94 D TC +C G L+ CDGC + +HQ Sbjct: 650 DDTCGICGD-----GGDLICCDGCPSTFHQ 674 >At5g36670.1 68418.m04388 PHD finger family protein Length = 1193 Score = 27.5 bits (58), Expect = 5.5 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 5/30 (16%) Query: 65 DLTCAVCRQIAVQAGNRLVECDGCRALYHQ 94 D TC +C G L+ CDGC + +HQ Sbjct: 650 DDTCGICGD-----GGDLICCDGCPSTFHQ 674 >At4g14760.1 68417.m02271 M protein repeat-containing protein contains Pfam profile: PF02370 M protein repeat Length = 1676 Score = 27.5 bits (58), Expect = 5.5 Identities = 10/34 (29%), Positives = 21/34 (61%) Query: 91 LYHQVGNVQPVLQHMDLQLIIQVKLHRAPSHHQE 124 L HQV NV +L+H +++++ + +A ++ E Sbjct: 1113 LEHQVSNVDEILEHREMEILEAEHMLKATNNENE 1146 >At1g05055.1 68414.m00506 basic transcription factor 2, 44kD subunit-related contains weak similarity to Swiss-Prot:Q13888 TFIIH basal transcription factor complex p44 subunit (Basic transcription factor 2 44 kDa subunit, BTF2-p44, General transcription factor IIH polypeptide 2) [Homo sapiens] Length = 421 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 67 TCAVCRQIAVQAGNRLVECDGCRALYH 93 +C C+Q + AGN+ V C CR H Sbjct: 361 SCFGCQQSLIGAGNKPVPCVTCRKCKH 387 >At1g05380.1 68414.m00546 PHD finger transcription factor, putative Length = 600 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Query: 65 DLTCAVCRQIAVQAGNRLVECDGCRALYHQ 94 D C +C G L+ CDGC + YHQ Sbjct: 87 DDACGICGD-----GGDLICCDGCPSTYHQ 111 >At2g18190.1 68415.m02116 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 494 Score = 26.6 bits (56), Expect = 9.6 Identities = 16/44 (36%), Positives = 21/44 (47%) Query: 48 DDGSVMDGELAFDLLEEDLTCAVCRQIAVQAGNRLVECDGCRAL 91 D V ELA +L++ED T V R + NR VE + L Sbjct: 412 DSTEVTPAELAEELMQEDDTDVVLRGVVSFVENRKVEISKTKEL 455 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,419,504 Number of Sequences: 28952 Number of extensions: 117049 Number of successful extensions: 256 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 242 Number of HSP's gapped (non-prelim): 20 length of query: 180 length of database: 12,070,560 effective HSP length: 77 effective length of query: 103 effective length of database: 9,841,256 effective search space: 1013649368 effective search space used: 1013649368 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -