BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000302-TA|BGIBMGA000302-PA|undefined (925 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 25 3.1 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 24 5.5 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 23 9.6 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Query: 295 RRSKNKKNLQRQEFNMQ 311 RR KNKKN QRQ Q Sbjct: 294 RRMKNKKNSQRQAAQQQ 310 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 23.8 bits (49), Expect = 5.5 Identities = 13/52 (25%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 470 FRPIRQNVYAILYNMHHHRFMAHKIKDDRSSGSNDRPCTVLIAEWIYTRTNP 521 F+P R +V+ ++ H F +++S+G+ C + +A R NP Sbjct: 464 FQP-RGSVFVRFTHLQHQPFTYKITVNNQSNGNRKGTCRIFLAPKTDERGNP 514 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 23.0 bits (47), Expect = 9.6 Identities = 15/41 (36%), Positives = 20/41 (48%) Query: 625 NINAISSRGVQLGALVMAGVEAALVANDACGAPVPWLVASP 665 NI + GVQL +A + ALV +P+P LV P Sbjct: 163 NIILGNGTGVQLVPTRLANGDIALVLPTQGASPLPLLVPIP 203 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.134 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,436 Number of Sequences: 317 Number of extensions: 8894 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 3 length of query: 925 length of database: 114,650 effective HSP length: 63 effective length of query: 862 effective length of database: 94,679 effective search space: 81613298 effective search space used: 81613298 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -