BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000302-TA|BGIBMGA000302-PA|undefined (925 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31G5.18c |||ubiquitin family, human C1ORF55 related|Schizosa... 28 6.9 SPAC1952.03 |||cysteine protease, OTU family|Schizosaccharomyces... 27 9.1 >SPAC31G5.18c |||ubiquitin family, human C1ORF55 related|Schizosaccharomyces pombe|chr 1|||Manual Length = 263 Score = 27.9 bits (59), Expect = 6.9 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Query: 281 GTKDGFLKYKTATGRRSKNKKNLQRQEFNMQPVTLDLDTSKLATESSEHEVSIHFSKR 338 G K GF A G R K+N Q + + + DLD ++L T E+S + +K+ Sbjct: 83 GGKGGFGSQLRAAGGRMSKKRNEQENQDSCR----DLDGNRLGTIRQAKELSEYLAKK 136 >SPAC1952.03 |||cysteine protease, OTU family|Schizosaccharomyces pombe|chr 1|||Manual Length = 324 Score = 27.5 bits (58), Expect = 9.1 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 3/77 (3%) Query: 272 KQAVQYYLNGTKDGFLKYKTATGRRSKNKKNLQRQEFNMQPVTLDLDTSKLATESSEHEV 331 K +VQ LN TK+ + + R K + ++ E +L++ K+A +E + Sbjct: 116 KSSVQSSLN-TKENTPQQPKKSRNRQKERLERRKAEMKKMSEQAELESEKMADLKNEEKK 174 Query: 332 SIHFSKRLEDYNMVTAN 348 FSK LE+ +V + Sbjct: 175 K--FSKILEEAGLVAVD 189 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,001,455 Number of Sequences: 5004 Number of extensions: 163122 Number of successful extensions: 319 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 319 Number of HSP's gapped (non-prelim): 2 length of query: 925 length of database: 2,362,478 effective HSP length: 79 effective length of query: 846 effective length of database: 1,967,162 effective search space: 1664219052 effective search space used: 1664219052 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -