GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000302-TA|BGIBMGA000302-PA|undefined
         (925 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein.            25   9.1  

>AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein.
          Length = 1152

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 420 PAEVLRTCAERHTRGLMHPQL--LSILTHRQVT-LPVLMEDENHREIPSIHHF 469
           PA +LR   E HT  L H Q+  LS +  + +T L  L  D N      +H F
Sbjct: 392 PAGLLRNTVELHTLRLSHNQIGELSAVALQALTKLQELYLDHNQLYTIELHAF 444


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.318    0.134    0.406 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 918,651
Number of Sequences: 2123
Number of extensions: 38171
Number of successful extensions: 52
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 50
Number of HSP's gapped (non-prelim): 3
length of query: 925
length of database: 516,269
effective HSP length: 70
effective length of query: 855
effective length of database: 367,659
effective search space: 314348445
effective search space used: 314348445
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 52 (25.0 bits)