GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000301-TA|BGIBMGA000301-PA|IPR013818|Lipase, N-terminal,
IPR008262|Lipase, active site, IPR000734|Lipase, IPR002331|Pancreatic
lipase
         (553 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z69735-1|CAA93623.1|  162|Tribolium castaneum initiation factor ...    23   5.5  

>Z69735-1|CAA93623.1|  162|Tribolium castaneum initiation factor
           5-like protein protein.
          Length = 162

 Score = 23.0 bits (47), Expect = 5.5
 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 380 ENEVYPSEEHETIGAKYFLSTGKEQPFCQRHYRVTIQLANPKGAESWVQG 429
           E E+  S +  TI ++   + G   P    H  VT  L NP      VQG
Sbjct: 20  ETELLVSTKRSTI-SQGCKACGYHSPLESNHKLVTFILKNPPNLNPAVQG 68


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.322    0.140    0.445 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,527
Number of Sequences: 317
Number of extensions: 6468
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 1
length of query: 553
length of database: 114,650
effective HSP length: 60
effective length of query: 493
effective length of database: 95,630
effective search space: 47145590
effective search space used: 47145590
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 45 (22.2 bits)