BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000301-TA|BGIBMGA000301-PA|IPR013818|Lipase, N-terminal, IPR008262|Lipase, active site, IPR000734|Lipase, IPR002331|Pancreatic lipase (553 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 25 1.6 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 6.6 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 25.0 bits (52), Expect = 1.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 508 VIVDHMELPSRGKRNVDFSSKLCTLKREFAEIP 540 V ++++E P KRN + S+ LK E P Sbjct: 172 VDINYVEYPQNSKRNSEESAICAMLKENMPEFP 204 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.0 bits (47), Expect = 6.6 Identities = 11/38 (28%), Positives = 18/38 (47%) Query: 359 AVMGFHADSTPGLVANRDNLTENEVYPSEEHETIGAKY 396 AVMG H D ++ D + + P+ +T+ KY Sbjct: 362 AVMGCHPDIQEKVIQELDEIFGDSDRPATFQDTLEMKY 399 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.140 0.445 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,039 Number of Sequences: 429 Number of extensions: 8102 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 2 length of query: 553 length of database: 140,377 effective HSP length: 61 effective length of query: 492 effective length of database: 114,208 effective search space: 56190336 effective search space used: 56190336 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -