GeneModel BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000297-TA|BGIBMGA000297-PA|undefined
         (71 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g58575.1 68418.m07339 expressed protein                             25   8.1  

>At5g58575.1 68418.m07339 expressed protein
          Length = 181

 Score = 24.6 bits (51), Expect = 8.1
 Identities = 10/33 (30%), Positives = 20/33 (60%)

Query: 35 SQLFISLVDQIVSSVVRKNIEIAIMPKIRHIDL 67
          SQ+F+ LVD +++ V  +   +A +   R +D+
Sbjct: 16 SQIFLDLVDSVIADVASECHRVARLGLDRDLDI 48


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.322    0.138    0.357 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,011,007
Number of Sequences: 28952
Number of extensions: 19236
Number of successful extensions: 26
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 25
Number of HSP's gapped (non-prelim): 1
length of query: 71
length of database: 12,070,560
effective HSP length: 51
effective length of query: 20
effective length of database: 10,594,008
effective search space: 211880160
effective search space used: 211880160
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 51 (24.6 bits)