BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000296-TA|BGIBMGA000296-PA|undefined (234 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 24 1.2 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 21 8.2 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 8.2 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 21 8.2 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 8.2 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 23.8 bits (49), Expect = 1.2 Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 185 GIFTGQRAQNSAEKADMECVYKISYKDFGKRCNIKFNTDTKELKFYAIRT 234 G T + A ++EK E ++K +D+ ++C + D KE+ + + T Sbjct: 244 GQITRRIAAVASEKIKNEIIWKKLREDYTRQCRLVRKVD-KEIAYIVLLT 292 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 128 LAEAMKVTAIYDKYDVNEYL 147 LAE K T YD D++E + Sbjct: 18 LAENSKYTTKYDNVDLDEII 37 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.0 bits (42), Expect = 8.2 Identities = 7/26 (26%), Positives = 15/26 (57%) Query: 206 KISYKDFGKRCNIKFNTDTKELKFYA 231 +I + D G+ + N + + +KF+A Sbjct: 479 EIHFIDIGENITVGVNPEPERMKFWA 504 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.0 bits (42), Expect = 8.2 Identities = 7/26 (26%), Positives = 15/26 (57%) Query: 206 KISYKDFGKRCNIKFNTDTKELKFYA 231 +I + D G+ + N + + +KF+A Sbjct: 481 EIHFIDIGENITVGVNPEPERMKFWA 506 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.0 bits (42), Expect = 8.2 Identities = 14/44 (31%), Positives = 18/44 (40%) Query: 45 NYIREDVWWSTAGTAQNMDAVQEYRVLLTSIIKQKASVACFLAE 88 NYI+ + ST T+ A Y S I AS+ F E Sbjct: 187 NYIKPQLHVSTGSTSSPTIASATYTNSANSSIWSPASIDSFTLE 230 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,500 Number of Sequences: 317 Number of extensions: 1922 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 5 length of query: 234 length of database: 114,650 effective HSP length: 55 effective length of query: 179 effective length of database: 97,215 effective search space: 17401485 effective search space used: 17401485 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -