GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000296-TA|BGIBMGA000296-PA|undefined
         (234 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY146726-1|AAO12086.1|  136|Anopheles gambiae odorant-binding pr...    23   5.9  

>AY146726-1|AAO12086.1|  136|Anopheles gambiae odorant-binding
           protein AgamOBP19 protein.
          Length = 136

 Score = 23.4 bits (48), Expect = 5.9
 Identities = 15/55 (27%), Positives = 23/55 (41%)

Query: 79  KASVACFLAEGDGSGRTLVGVNMCLPQEKGRFVDHKPPKTKAGLLSLRMLAEAMK 133
           K  V+C L     + +  V     L Q      DH  P  +AGL + +  A+ +K
Sbjct: 59  KCYVSCLLDIMQVARKGKVNYEKSLKQIDTMLPDHMKPAFRAGLEACKSAAQGVK 113


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.135    0.398 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 228,243
Number of Sequences: 2123
Number of extensions: 8552
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 1
length of query: 234
length of database: 516,269
effective HSP length: 62
effective length of query: 172
effective length of database: 384,643
effective search space: 66158596
effective search space used: 66158596
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 47 (23.0 bits)