BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000296-TA|BGIBMGA000296-PA|undefined (234 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73971-4|CAA98254.1| 205|Caenorhabditis elegans Hypothetical pr... 28 6.6 AF014940-2|AAB63934.1| 232|Caenorhabditis elegans Hypothetical ... 28 6.6 >Z73971-4|CAA98254.1| 205|Caenorhabditis elegans Hypothetical protein C50H2.6 protein. Length = 205 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 6/42 (14%) Query: 168 LRARINLARELRFRVTG------GIFTGQRAQNSAEKADMEC 203 L A+I L++E+RF++T G+F+ Q AEK +M C Sbjct: 122 LHAKILLSKEVRFQLTMKFERNCGVFSKAEIQTLAEKYNMTC 163 >AF014940-2|AAB63934.1| 232|Caenorhabditis elegans Hypothetical protein W02D7.4 protein. Length = 232 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Query: 153 SVTPEYRGLGIAVELLRARINLARELRFRVTGGIF---TGQRAQNSAEKADMECVYKISY 209 SV P++ LGIA +++ + R L+ GG+ T Q EKA +C+ ++ Y Sbjct: 138 SVAPQFTRLGIATKMVTTNMT-KRNLKKYNIGGVLSETTSLANQIVLEKAGFKCLKELPY 196 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.320 0.135 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,430,989 Number of Sequences: 27539 Number of extensions: 202913 Number of successful extensions: 405 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 405 Number of HSP's gapped (non-prelim): 2 length of query: 234 length of database: 12,573,161 effective HSP length: 79 effective length of query: 155 effective length of database: 10,397,580 effective search space: 1611624900 effective search space used: 1611624900 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -