BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000295-TA|BGIBMGA000295-PA|IPR005225|Small GTP-binding protein domain, IPR001806|Ras GTPase, IPR013753|Ras, IPR003579|Ras small GTPase, Rab type (218 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.9 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 6.8 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Query: 184 MSESLDSEPAMLAGGARGQRLTEQPQGSNNPNCNC 218 M E+++ +L A + L E G N NCNC Sbjct: 652 MIETMELTSLLLTKVAEDRPLPEFYIGGNPFNCNC 686 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 147 GRQLADQLGVEFYETSAKENINVKAVFERLVDIIC 181 GR +D + + A +N+ +VF R+ ++IC Sbjct: 250 GRLSSDNMSKKSPVRKATLFLNMASVFMRIFNLIC 284 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.132 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,717 Number of Sequences: 429 Number of extensions: 1876 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 218 length of database: 140,377 effective HSP length: 55 effective length of query: 163 effective length of database: 116,782 effective search space: 19035466 effective search space used: 19035466 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -