BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000294-TA|BGIBMGA000294-PA|undefined (232 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974160-1|ABJ52800.1| 235|Anopheles gambiae serpin 1 protein. 24 3.3 >DQ974160-1|ABJ52800.1| 235|Anopheles gambiae serpin 1 protein. Length = 235 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/41 (26%), Positives = 23/41 (56%) Query: 131 AVADVAKETTTSSMPRIEQIANKFNISDEEKSNKSSSYSQL 171 A AD AK++TT + ++ ++ K I EK + + +++ Sbjct: 148 ASADYAKQSTTKNEVQVSKMLQKAGIEINEKGTLAFAATEI 188 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.312 0.130 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 240,281 Number of Sequences: 2123 Number of extensions: 9445 Number of successful extensions: 7 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 1 length of query: 232 length of database: 516,269 effective HSP length: 62 effective length of query: 170 effective length of database: 384,643 effective search space: 65389310 effective search space used: 65389310 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -