SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000291-TA|BGIBMGA000291-PA|IPR002076|GNS1/SUR4 membrane
protein
         (283 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier...    25   0.58 

>AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier
           protein JHBP-1 protein.
          Length = 253

 Score = 25.4 bits (53), Expect = 0.58
 Identities = 13/53 (24%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 223 SDFYKQAYLRKSKKAKSMMKVEDEPVKYETKEMKLPLLNGFSNGSALGDVRQR 275
           +D Y + Y    K  ++ ++++   VK+   ++KL   N F     LG+   R
Sbjct: 159 NDIYCEKY---EKNGETYLRIKKHAVKFNPAKVKLRFENLFDGNKELGEQMNR 208


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.330    0.141    0.469 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 77,849
Number of Sequences: 429
Number of extensions: 3130
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 1
length of query: 283
length of database: 140,377
effective HSP length: 57
effective length of query: 226
effective length of database: 115,924
effective search space: 26198824
effective search space used: 26198824
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 43 (21.4 bits)

- SilkBase 1999-2023 -