BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000289-TA|BGIBMGA000289-PA|IPR002816|TraB determinant (300 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 22 6.4 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 6.4 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 21 8.5 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 21 8.5 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 21 8.5 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 22 TAKPNTVQTYYSQKVLLRKKSDVS 45 ++ P + + YY+QK L +D S Sbjct: 101 SSTPESPEHYYNQKTLQANNNDAS 124 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 5 ICVIARQLLFKNIESIVTAKPNTVQTYYSQKVLLRK 40 IC A QLLF N++ + + T Q +LL + Sbjct: 199 ICESAAQLLFMNVQWVRSIPAFTCLPLSDQLLLLEE 234 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 21.4 bits (43), Expect = 8.5 Identities = 11/45 (24%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 167 QKIPGCKLYLGDRPIQITIARAFQSLSVYELGQVLYHISTSNPKP 211 + +PGC+ Y GD ++ +I ++ + G H + KP Sbjct: 215 EDVPGCEDYYGDLDLK-SIRKSELLAGLQSSGSSRSHQPATKSKP 258 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.4 bits (43), Expect = 8.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 181 IQITIARAFQSLSVYELGQVLYHISTSNPKPLD 213 IQ +AR + S YE + + S NP+P D Sbjct: 110 IQTQVARPPPARSPYEWIKKTSYQSQPNPEPAD 142 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 21.4 bits (43), Expect = 8.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 181 IQITIARAFQSLSVYELGQVLYHISTSNPKPLD 213 IQ +AR + S YE + + S NP+P D Sbjct: 110 IQTQVARPPPARSPYEWIKKTSYQSQPNPEPAD 142 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.137 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,383 Number of Sequences: 317 Number of extensions: 2599 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 6 length of query: 300 length of database: 114,650 effective HSP length: 56 effective length of query: 244 effective length of database: 96,898 effective search space: 23643112 effective search space used: 23643112 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -